MED26 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB125517-Each-of-1 | In Stock | ₹ 41,710.50 |
NB125517 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
MED26
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
Activator-recruited cofactor 70 kDa component, Cofactor required for Sp1 transcriptional activation subunit 7, cofactor required for Sp1 transcriptional activation, subunit 7 (70kD), cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa, CRSP70ARC70, CRSP7CRSP complex subunit 7, mediator complex subunit 26Transcriptional coactivator CRSP70, mediator of RNA polymerase II transcription subunit 26
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MED26 (NP_004822). Peptide sequence SSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIE
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
9441
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description MED26 Polyclonal specifically detects MED26 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: MED26
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: Activator-recruited cofactor 70 kDa component, Cofactor required for Sp1 transcriptional activation subunit 7, cofactor required for Sp1 transcriptional activation, subunit 7 (70kD), cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa, CRSP70ARC70, CRSP7CRSP complex subunit 7, mediator complex subunit 26Transcriptional coactivator CRSP70, mediator of RNA polymerase II transcription subunit 26
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MED26 (NP_004822). Peptide sequence SSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIE
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 9441
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: ATP7A
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: ATPase, Cu++ transporting, alpha polypeptide, Copper pump 1, copper-transporting ATPase 1, Cu++-transporting P-type ATPase, DSMAX, EC 3.6.3, EC 3.6.3.4, MC1, Menkes disease-associated protein, Menkes syndrome, MK, MNKFLJ17790, OHS, SMAX3
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP7A (NP_000043). Peptide sequence SSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGL
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 538
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: KIF27
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: kinesin family member 27
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIF27 (NP_060046). Peptide sequence ELEADLKKREAIVSKKEALLQEKSHLENKKLRSSQALNTDSLKISTRLNL
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 55582
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
