TR beta 1/NR1A2/Thyroid Hormone Receptor beta Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB125727-Each-of-1 | In Stock | ₹ 41,710.50 |
NB125727 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
TR beta 1/NR1A2/Thyroid Hormone Receptor beta
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Gene Alias
avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, c-erbA-2, c-erbA-beta, ERBA2MGC126109, ERBA-BETA, GRTH, MGC126110, NR1A2thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog 2), Nuclear receptor subfamily 1 group A member 2, oncogene ERBA2, PRTH, THR1pituitary resistance to thyroid hormone, THRB1, THRB2, thyroid hormone receptor beta, thyroid hormone receptor beta 1, thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a)oncogene homolog 2, avian)
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of mouse TR beta 1/NR1A2/Thyroid Hormone Receptor beta (NP_033406). Peptide sequence MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY
Quantity
100 μg
Research Discipline
Cancer, Neuroscience
Gene ID (Entrez)
7068
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
ChIP Assay
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Mouse
Form
Purified
Related Products
Description
- TR beta 1/NR1A2/Thyroid Hormone Receptor beta Polyclonal specifically detects TR beta 1/NR1A2/Thyroid Hormone Receptor beta in Mouse samples
- It is validated for Western Blot, Chromatin Immunoprecipitation.
Compare Similar Items
Show Difference
Antigen: TR beta 1/NR1A2/Thyroid Hormone Receptor beta
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Gene Alias: avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, c-erbA-2, c-erbA-beta, ERBA2MGC126109, ERBA-BETA, GRTH, MGC126110, NR1A2thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog 2), Nuclear receptor subfamily 1 group A member 2, oncogene ERBA2, PRTH, THR1pituitary resistance to thyroid hormone, THRB1, THRB2, thyroid hormone receptor beta, thyroid hormone receptor beta 1, thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a)oncogene homolog 2, avian)
Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of mouse TR beta 1/NR1A2/Thyroid Hormone Receptor beta (NP_033406). Peptide sequence MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY
Quantity: 100 μg
Research Discipline: Cancer, Neuroscience
Gene ID (Entrez): 7068
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: ChIP Assay
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Mouse
Form: Purified
Antigen: RNA polymerase I termination factor
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: RNA polymerase I termination factor, transcription termination factor 1, Transcription termination factor I, transcription termination factor, RNA polymerase I, TTF-1, TTF-I
Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of mouse RNA polymerase I termination factor (NP_033468). Peptide sequence RRASQTPAQETLESEWPQKAKRKKRRREPQTPAQETLESEWPQKAKKKKR
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 7270
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Mouse
Form: Purified
Antigen: AHRR
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: AHH, AHHR, AhR repressor, AhRR, aryl hydrocarbon receptor regulator, aryl hydrocarbon receptor repressor, arylhydrocarbon receptor repressor, aryl-hydrocarbon receptor repressor, BHLHE77, Class E basic helix-loop-helix protein 77, dioxin receptor repressor, KIAA1234bHLHe77aryl hydrocarbon hydroxylase regulator, MGC167813, MGC176630
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_033774). Peptide sequence CLRGGPDLLDPKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETPV
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 57491
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Mouse
Form: Purified
