CaMKII beta Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB126161-Each-of-1 | In Stock | ₹ 41,710.50 |
NB126161 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
CaMKII beta
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
calcium/calmodulin-dependent protein kinase (CaM kinase) II beta, calcium/calmodulin-dependent protein kinase II beta, calcium/calmodulin-dependent protein kinase type II beta chain, calcium/calmodulin-dependent protein kinase type II subunit beta, CaM kinase II beta subunit, CaM kinase II subunit beta, CAM2CAMK2, CAMKB, CaMK-II subunit beta, CaM-kinase II beta chain, EC 2.7.11, EC 2.7.11.17, MGC29528, proline rich calmodulin-dependent protein kinase
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat CaMKII beta (NP_001035813). Peptide sequence DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG
Quantity
100 μg
Research Discipline
Protein Kinase, Wnt Signaling Pathway
Gene ID (Entrez)
816
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Rat
Form
Purified
Related Products
Description
- CaMKII beta Polyclonal specifically detects CaMKII beta in Rat samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: CaMKII beta
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: calcium/calmodulin-dependent protein kinase (CaM kinase) II beta, calcium/calmodulin-dependent protein kinase II beta, calcium/calmodulin-dependent protein kinase type II beta chain, calcium/calmodulin-dependent protein kinase type II subunit beta, CaM kinase II beta subunit, CaM kinase II subunit beta, CAM2CAMK2, CAMKB, CaMK-II subunit beta, CaM-kinase II beta chain, EC 2.7.11, EC 2.7.11.17, MGC29528, proline rich calmodulin-dependent protein kinase
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat CaMKII beta (NP_001035813). Peptide sequence DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG
Quantity: 100 μg
Research Discipline: Protein Kinase, Wnt Signaling Pathway
Gene ID (Entrez): 816
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Rat
Form: Purified
Antigen: Elp4
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: C11orf19, chromosome 11 open reading frame 19, dJ68P15A.1, elongation protein 4 homolog (S. cerevisiae), elongator complex protein 4, hELP4, PAX6 neighbor gene protein, PAX6NEB, PAXNEBFLJ20498
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human Elp4. Peptide sequence TMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIR
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 26610
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: DIA1
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: C3orf58, chromosome 3 open reading frame 58, DIA1
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse DIA1 (NP_001028317). Peptide sequence FLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPR
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 205428
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Mouse
Form: Purified
