ARID2 Antibody, Alexa Fluor™ 647, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB126615AFX-Each-of-1 | In Stock | ₹ 58,351.92 |
NB126615AFX - Each of 1
In Stock
Quantity
1
Base Price: ₹ 58,351.92
GST (18%): ₹ 10,503.346
Total Price: ₹ 68,855.266
Antigen
ARID2
Classification
Polyclonal
Dilution
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
Gene Alias
ARID domain-containing protein 2, AT rich interactive domain 2 (ARID, RFX-like), BAF200KIAA1557AT-rich interactive domain-containing protein 2, BRG1-associated factor 200, DKFZp686G052, DKFZp779P0222, FLJ30619, p200, Zinc finger protein with activation potential, zipzap, zipzap/p200
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
196528
Content And Storage
Store at 4C in the dark.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Alexa Fluor 647
Formulation
50mM Sodium Borate with 0.05% Sodium Azide
Gene Symbols
ARID2
Immunogen
The immunogen recognized by this antibody maps to a region between residue 1785 and 1835 of human AT rich interactive domain 2 using the numbering given in entry NP_689854.2 (GeneID 196528).
Quantity
100 μL
Primary or Secondary
Primary
Target Species
Human, Mouse
Isotype
IgG
Related Products
Description
- ARID2 Polyclonal specifically detects ARID2 in Human, Mouse samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ARID2
Classification: Polyclonal
Dilution: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
Gene Alias: ARID domain-containing protein 2, AT rich interactive domain 2 (ARID, RFX-like), BAF200KIAA1557AT-rich interactive domain-containing protein 2, BRG1-associated factor 200, DKFZp686G052, DKFZp779P0222, FLJ30619, p200, Zinc finger protein with activation potential, zipzap, zipzap/p200
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 196528
Content And Storage: Store at 4C in the dark.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Alexa Fluor 647
Formulation: 50mM Sodium Borate with 0.05% Sodium Azide
Gene Symbols: ARID2
Immunogen: The immunogen recognized by this antibody maps to a region between residue 1785 and 1835 of human AT rich interactive domain 2 using the numbering given in entry NP_689854.2 (GeneID 196528).
Quantity: 100 μL
Primary or Secondary: Primary
Target Species: Human, Mouse
Isotype: IgG
Antigen: FAM149B1
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: family with sequence similarity 149, member B1, KIAA0974hypothetical protein LOC317662
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 317662
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Gene Symbols: __
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse FAM149B11 (NP_001019683.1). Peptide sequence QSARRRNPPPRTLHPISTSHSRAGTPWPVEEILRGPRVPVTADTLSSPSP
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Mouse
Isotype: __
Antigen: C12orf4
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: chromosome 12 open reading frame 4, hypothetical protein LOC57102
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 57102
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Gene Symbols: __
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse C12orf4 (NP_613060.1). Peptide sequence SQQDLENKWSNELKQSTAIQKQEYQEWVIKLHQDLKNPNNSSLSEEIKVQ
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Mouse
Isotype: __
