Integrin alpha 5/CD49e Rabbit anti-Human, Mouse, Rat, Clone: 8F2O6, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB166386-Each-of-1 | In Stock | ₹ 17,582.58 |
NB166386 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 17,582.58
GST (18%): ₹ 3,164.864
Total Price: ₹ 20,747.444
Antigen
Integrin alpha 5/CD49e
Classification
Monoclonal
Conjugate
Unconjugated
Formulation
PBS, 0.05% BSA, 50% glycerol, pH7.3
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Form
Purified
Applications
Western Blot, Flow Cytometry, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Clone
8F2O6
Dilution
Western Blot 1:500 - 1:2000, Flow Cytometry 1:50 - 1:200, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin
Gene Alias
CD49 antigen-like family member E, CD49e, CD49e antigen, Fibronectin receptor subunit alpha, fibronectin receptor, alpha subunit, FNRAVLA5A, integrin alpha-5, Integrin alpha-F, integrin, alpha 5 (fibronectin receptor, alpha polypeptide), very late activation protein 5, alpha subunit, VLA-5
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5/CD49e (P08648). HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Quantity
20 μg
Research Discipline
CD Markers, Cell Biology, Cytoskeleton Markers, GPCR, Immunology, Signal Transduction, Stem Cells
Gene ID (Entrez)
3678
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
Isotype
IgG
Related Products
Description
- Integrin alpha 5/CD49e Monoclonal antibody specifically detects Integrin alpha 5/CD49e in Human, Mouse, Rat samples
- It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: Integrin alpha 5/CD49e
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Purified
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Clone: 8F2O6
Dilution: Western Blot 1:500 - 1:2000, Flow Cytometry 1:50 - 1:200, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin
Gene Alias: CD49 antigen-like family member E, CD49e, CD49e antigen, Fibronectin receptor subunit alpha, fibronectin receptor, alpha subunit, FNRAVLA5A, integrin alpha-5, Integrin alpha-F, integrin, alpha 5 (fibronectin receptor, alpha polypeptide), very late activation protein 5, alpha subunit, VLA-5
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5/CD49e (P08648). HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Quantity: 20 μg
Research Discipline: CD Markers, Cell Biology, Cytoskeleton Markers, GPCR, Immunology, Signal Transduction, Stem Cells
Gene ID (Entrez): 3678
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: Integrin alpha 6/CD49f
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Clone: 4E4K6
Dilution: __
Gene Alias: CD49 antigen-like family member F, CD49f, CD49f antigen, DKFZp686J01244, FLJ18737, integrin alpha-6, integrin alpha6B, integrin, alpha 6, ITGA6B, VLA-6
Immunogen: A synthesized peptide derived from human Integrin alpha 6/CD49f (ITGA6/CD49f)
Quantity: 100 μg
Research Discipline: Signal Transduction
Gene ID (Entrez): 3655
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: Integrin alpha 6/CD49f
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Clone: 4E4K6
Dilution: __
Gene Alias: CD49 antigen-like family member F, CD49f, CD49f antigen, DKFZp686J01244, FLJ18737, integrin alpha-6, integrin alpha6B, integrin, alpha 6, ITGA6B, VLA-6
Immunogen: A synthesized peptide derived from human Integrin alpha 6/CD49f (ITGA6/CD49f)
Quantity: 20 μg
Research Discipline: Signal Transduction
Gene ID (Entrez): 3655
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Isotype: IgG
