SGLT2/SLC5A2 Rabbit anti-Human, Mouse, Rat, Polyclonal, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB167074-Each-of-1 | In Stock | ₹ 13,655.38 |
NB167074 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 13,655.38
GST (18%): ₹ 2,457.968
Total Price: ₹ 16,113.348
Antigen
SGLT2/SLC5A2
Classification
Polyclonal
Dilution
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 564-624 of human SGLT2/SLC5A2 (NP_003032.1). RHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGS
Quantity
20 μg
Research Discipline
Apoptosis, Cancer, Tumor Suppressors
Gene ID (Entrez)
6524
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, 50% glycerol, pH7.3
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Form
Purified
Related Products
Description
- Description SGLT2/SLC5A2 Polyclonal antibody specifically detects SGLT2/SLC5A2 in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: SGLT2/SLC5A2
Classification: Polyclonal
Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 564-624 of human SGLT2/SLC5A2 (NP_003032.1). RHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGS
Quantity: 20 μg
Research Discipline: Apoptosis, Cancer, Tumor Suppressors
Gene ID (Entrez): 6524
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, 50% glycerol, pH7.3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Purified
Antigen: SARS-CoV-2 nsp2
Classification: Polyclonal
Dilution: __
Gene Alias: Non-structural protein 2, NSP2, p65 homolog
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of coronavirus NSP2 (YP_009742609.1).
Quantity: 100 μg
Research Discipline: Infections (Virus Bacteria and Parasites)
Gene ID (Entrez): 43740578
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS, 50% glycerol, pH7.3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: SARS-CoV-2
Form: Purified
Antigen: SARS-CoV-2 nsp2
Classification: Polyclonal
Dilution: __
Gene Alias: Non-structural protein 2, NSP2, p65 homolog
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of coronavirus NSP2 (YP_009742609.1).
Quantity: 20 μg
Research Discipline: Infections (Virus Bacteria and Parasites)
Gene ID (Entrez): 43740578
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS, 50% glycerol, pH7.3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: SARS-CoV-2
Form: Purified
