Calreticulin Antibody (6C6), DyLight 755, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB236998-Each-of-1 | In Stock | ₹ 45,902.94 |
NB236998 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 45,902.94
GST (18%): ₹ 8,262.529
Total Price: ₹ 54,165.469
Antigen
Calreticulin
Classification
Monoclonal
Conjugate
DyLight 755
Formulation
50mM Sodium Borate
Host Species
Mouse
Purification Method
Immunogen affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Form
Purified
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Clone
6C6
Dilution
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Gene Alias
autoantigen Ro, CALR, calregulin, calreticulin, cC1qR, CRP55, CRT, Endoplasmic reticulum resident protein 60, epididymis secretory sperm binding protein Li 99n, ERp60, FLJ26680, grp60, HACBP, HEL-S-99n, RO, Sicca syndrome antigen A (autoantigen Ro; calreticulin), SSA
Immunogen
Calreticulin Antibody (6C6) was developed against a synthetic peptide VESGSLEDDWDFLPPKKI corresponding to amino acids 191-208 of human Calreticulin, including the LC3 interacting region or LIR. [UniProt# P27797]
Quantity
0.1 mL
Research Discipline
Autophagy, Cancer, Cellular Markers, ER Markers, Immunology, Membrane Trafficking and Chaperones, Neurodegeneration, Neuroscience, Signal Transduction
Gene ID (Entrez)
811
Content And Storage
Store at 4C in the dark.
Isotype
IgG1
Related Products
Description
- Calreticulin Monoclonal antibody specifically detects Calreticulin in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunofluorescence
Compare Similar Items
Show Difference
Antigen: Calreticulin
Classification: Monoclonal
Conjugate: DyLight 755
Formulation: 50mM Sodium Borate
Host Species: Mouse
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Purified
Applications: Western Blot, Immunohistochemistry, Immunofluorescence
Clone: 6C6
Dilution: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Gene Alias: autoantigen Ro, CALR, calregulin, calreticulin, cC1qR, CRP55, CRT, Endoplasmic reticulum resident protein 60, epididymis secretory sperm binding protein Li 99n, ERp60, FLJ26680, grp60, HACBP, HEL-S-99n, RO, Sicca syndrome antigen A (autoantigen Ro; calreticulin), SSA
Immunogen: Calreticulin Antibody (6C6) was developed against a synthetic peptide VESGSLEDDWDFLPPKKI corresponding to amino acids 191-208 of human Calreticulin, including the LC3 interacting region or LIR. [UniProt# P27797]
Quantity: 0.1 mL
Research Discipline: Autophagy, Cancer, Cellular Markers, ER Markers, Immunology, Membrane Trafficking and Chaperones, Neurodegeneration, Neuroscience, Signal Transduction
Gene ID (Entrez): 811
Content And Storage: Store at 4C in the dark.
Isotype: IgG1
Antigen: Pygopus-2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Immunofluorescence
Clone: __
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias: 1190004M21Rik, FLJ33226, pygopus 2, pygopus homolog 2, pygopus homolog 2 (Drosophila)
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSTGRKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVDHLVASNPFEDDFGAPKVGVAAPPF
Quantity: 25 μg
Research Discipline: __
Gene ID (Entrez): 90780
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: ZNF787
Classification: Polyclonal
Conjugate: Alexa Fluor 532
Formulation: 50mM Sodium Borate
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Clone: __
Dilution: Western Blot
Gene Alias: TIP20, transcription termination factor I interacting peptide 20, TTF-I interacting peptide 20, TTF-I-interacting peptide 20, zinc finger protein 787
Immunogen: The immunogen for this product maps to a region between residue 200 and 250 of human Zinc Finger Protein 787 using the numbering given in entry NP_001002836.2 (GeneID 126208).
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 126208
Content And Storage: Store at 4C in the dark.
Isotype: IgG
