Nav1.6 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB237400-Each-of-1 | In Stock | ₹ 28,234.80 |
NB237400 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 28,234.80
GST (18%): ₹ 5,082.264
Total Price: ₹ 33,317.064
Antigen
Nav1.6
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias
CerIII, hNa6/Scn8a voltage-gated sodium channel, MED, NaCh6, Nav1.6, PN4, sodium channel protein type 8 subunit alpha, Sodium channel protein type VIII subunit alpha, sodium channel, voltage gated, type VIII, alpha polypeptide, sodium channel, voltage gated, type VIII, alpha subunit, Voltage-gated sodium channel subunit alpha Nav1.6
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EMNNLQISVIRIKKGVAWTKLKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTT
Quantity
25 μg
Research Discipline
Neurodegeneration, Neuroscience
Gene ID (Entrez)
6334
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, 40% glycerol
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- Nav1.6 Polyclonal antibody specifically detects Nav1.6 in Human samples
- It is validated for Immunofluorescence
Compare Similar Items
Show Difference
Antigen: Nav1.6
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias: CerIII, hNa6/Scn8a voltage-gated sodium channel, MED, NaCh6, Nav1.6, PN4, sodium channel protein type 8 subunit alpha, Sodium channel protein type VIII subunit alpha, sodium channel, voltage gated, type VIII, alpha polypeptide, sodium channel, voltage gated, type VIII, alpha subunit, Voltage-gated sodium channel subunit alpha Nav1.6
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EMNNLQISVIRIKKGVAWTKLKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTT
Quantity: 25 μg
Research Discipline: Neurodegeneration, Neuroscience
Gene ID (Entrez): 6334
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: CENPA
Classification: Monoclonal
Dilution: Western Blot, Immunocytochemistry/Immunofluorescence
Gene Alias: Centromere autoantigen A, centromere protein A (17kD), centromere protein ACENP-Acentromere protein A, 17kDa, histone H3-like centromeric protein A
Immunogen: Synthetic peptide corresponding to a portion of human CENP-A
Quantity: 0.1 mL
Research Discipline: Cell Biology, Cell Cycle and Replication
Gene ID (Entrez): 1058
Content And Storage: Store at 4C in the dark.
Isotype: IgG1
Applications: Western Blot, Immunofluorescence
Conjugate: Alexa Fluor 594
Formulation: 50mM Sodium Borate
Host Species: Mouse
Purification Method: Protein G purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: GTF3A
Classification: Polyclonal
Dilution: Western Blot
Gene Alias: general transcription factor IIIA, TFIIIAAP2, transcription factor IIIA
Immunogen: The immunogen recognized by this antibody maps to this antibody using the numbering given in entry NP_002088.2 (GeneID 2971).
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 2971
Content And Storage: Store at 4C in the dark.
Isotype: IgG
Applications: Western Blot
Conjugate: DyLight 755
Formulation: 50mM Sodium Borate
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
