Hsp47 Antibody (M16.10A1), Biotin, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB239260-Each-of-1 | In Stock | ₹ 68,020.20 |
NB239260 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 68,020.20
GST (18%): ₹ 12,243.636
Total Price: ₹ 80,263.836
Antigen
Hsp47
Classification
Monoclonal
Conjugate
Biotin
Formulation
PBS
Host Species
Mouse
Purification Method
Protein G purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Chicken
Form
Purified
Applications
Western Blot, Flow Cytometry, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone
M16.10A1
Dilution
Western Blot, Simple Western, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Alias
(collagen binding protein 1), Arsenic-transactivated protein 3, AsTP3, CBP1, CBP2RA-A47, Cell proliferation-inducing gene 14 protein, Collagen-binding protein, colligen, Colligin, colligin-1, colligin-2, gp46, HSP47serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1), member 2, member 2, (collagen-binding protein 2), PPROM, proliferation-inducing gene 14, rheumatoid arthritis antigen A-47,47 kDa heat shock protein, Rheumatoid arthritis-related antigen RA-A47, serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), serpin H1, serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, SERPINH2colligin
Immunogen
Native rat HSP47.
Quantity
0.2 mL
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)
871
Content And Storage
Store at 4C in the dark.
Isotype
IgG2b
Related Products
Description
- Hsp47 Monoclonal antibody specifically detects Hsp47 in Human, Mouse, Rat, Porcine, Bovine, Canine, Chicken, Guinea Pig, Hamster, Monkey, Rabbit, Sheep samples
- It is validated for Western Blot, Western Blot, Flow Cytometry, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Compare Similar Items
Show Difference
Antigen: Hsp47
Classification: Monoclonal
Conjugate: Biotin
Formulation: PBS
Host Species: Mouse
Purification Method: Protein G purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Chicken
Form: Purified
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone: M16.10A1
Dilution: Western Blot, Simple Western, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Alias: (collagen binding protein 1), Arsenic-transactivated protein 3, AsTP3, CBP1, CBP2RA-A47, Cell proliferation-inducing gene 14 protein, Collagen-binding protein, colligen, Colligin, colligin-1, colligin-2, gp46, HSP47serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1), member 2, member 2, (collagen-binding protein 2), PPROM, proliferation-inducing gene 14, rheumatoid arthritis antigen A-47,47 kDa heat shock protein, Rheumatoid arthritis-related antigen RA-A47, serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), serpin H1, serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, SERPINH2colligin
Immunogen: Native rat HSP47.
Quantity: 0.2 mL
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 871
Content And Storage: Store at 4C in the dark.
Isotype: IgG2b
Antigen: Carbonic Anhydrase IX/CA9
Classification: Monoclonal
Conjugate: DyLight 488
Formulation: 50mM Sodium Borate
Host Species: Mouse
Purification Method: Protein A or G purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Equine
Form: Purified
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clone: PN-15
Dilution: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
Gene Alias: CAIX, CA-IX, Carbonate dehydratase IX, carbonic anhydrase 9, carbonic anhydrase IX, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MN, P54/58N, PMW1, RCC-associated antigen G250, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250
Immunogen: Microsomal fraction of human renal cortical tissue homogenate
Quantity: 0.1 mL
Research Discipline: Cancer, HIF Target Genes, Hypoxia, Lipid and Metabolism, Metastasis, Renal Cell Carcinoma Cell Markers
Gene ID (Entrez): 768
Content And Storage: Store at 4C in the dark.
Isotype: IgG2b κ
Antigen: HRAS
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Immunofluorescence
Clone: __
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias: C-BAS/HAS;C-HA-RAS1;C-H-RAS;CTLO;GTPase HRas;HAMSV;HRAS1;H-RASIDX;p21ras;RASH1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VREIRQHKLRKLNPPDESGPGCMSCKCVLS
Quantity: 100 μg
Research Discipline: Cell Cycle and Replication, Metastasis, mTOR Pathway
Gene ID (Entrez): 3265
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
