B3GALNT2 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB301159-Each-of-1 | In Stock | ₹ 45,731.82 |
NB301159 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 45,731.82
GST (18%): ₹ 8,231.728
Total Price: ₹ 53,963.548
Antigen
B3GALNT2
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias
B3GalNAc-T2, beta 1,3-N-acetylgalactosaminyltransferase-II (MGC39558), beta-1,3-galactosaminyltransferase 2, Beta-1,3-GalNAc-T2, beta-1,3-N-acetylgalactosaminyltransferase 2, Beta-1,3-N-acetylgalactosaminyltransferase II, EC 2.4.1, EC 2.4.1.-, MGC39558, UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 2, UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 2
Immunogen
This antibody has been engineered to specifically recognize the recombinant protein B3GALNT2 using the following amino acid sequence: WTVETTSFNLLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDV
Quantity
100 μL
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Western Blot, Immunocytochemistry
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, 40% glycerol
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
148789
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Related Products
Description
- B3GALNT2 Polyclonal antibody specifically detects B3GALNT2 in Human samples
- It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Compare Similar Items
Show Difference
Antigen: B3GALNT2
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: B3GalNAc-T2, beta 1,3-N-acetylgalactosaminyltransferase-II (MGC39558), beta-1,3-galactosaminyltransferase 2, Beta-1,3-GalNAc-T2, beta-1,3-N-acetylgalactosaminyltransferase 2, Beta-1,3-N-acetylgalactosaminyltransferase II, EC 2.4.1, EC 2.4.1.-, MGC39558, UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 2, UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 2
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein B3GALNT2 using the following amino acid sequence: WTVETTSFNLLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDV
Quantity: 100 μL
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot, Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 148789
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: ATP8B2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: ATPase, class I, type 8B, member 2, ATPIDprobable phospholipid-transporting ATPase ID, DKFZp434M0219, EC 3.6.3, EC 3.6.3.1, KIAA1137ATPase class I type 8B member 2, phospholipid-transporting ATPase ID
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ATP8B2 using the following amino acid sequence: AREKMMDSSRSVGNGFTYQDKLSSSKLTSVLEAVAG
Quantity: 100 μL
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 57198
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: ATG12
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: Apg12 (autophagy 12, S. cerevisiae)-like, APG12 autophagy 12-like (S. cerevisiae), APG12HAPG12, APG12-like, ATG12 autophagy related 12 homolog (S. cerevisiae), Autophagy-related protein 12, FBR93, ubiquitin-like protein ATG12, yeast) homolog
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ATG12 using the following amino acid sequence: SEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW
Quantity: 100 μL
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 9140
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
