PPP3CC Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB301387-Each-of-1 | In Stock | ₹ 45,731.82 |
NB301387 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 45,731.82
GST (18%): ₹ 8,231.728
Total Price: ₹ 53,963.548
Antigen
PPP3CC
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias
Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent calcineurin A subunit gamma isoform, CALNA3CAM-PRP catalytic subunit, CNA3, EC 3.1.3.16, PP2Bgamma, protein phosphatase 2B, catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform(calcineurin A gamma), protein phosphatase 3, catalytic subunit, gamma isozyme, serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
Immunogen
This antibody has been engineered to specifically recognize the recombinant protein PPP3CC using the following amino acid sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN
Quantity
100 μL
Research Discipline
B Cell Development and Differentiation Markers, Cell Biology, Cytoskeleton Markers, Immunology, Neurodegeneration, Neuroscience, Signal Transduction
Gene ID (Entrez)
5533
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Western Blot, Immunocytochemistry
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, 40% glycerol
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- PPP3CC Polyclonal antibody specifically detects PPP3CC in Human samples
- It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Compare Similar Items
Show Difference
Antigen: PPP3CC
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent calcineurin A subunit gamma isoform, CALNA3CAM-PRP catalytic subunit, CNA3, EC 3.1.3.16, PP2Bgamma, protein phosphatase 2B, catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform(calcineurin A gamma), protein phosphatase 3, catalytic subunit, gamma isozyme, serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein PPP3CC using the following amino acid sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN
Quantity: 100 μL
Research Discipline: B Cell Development and Differentiation Markers, Cell Biology, Cytoskeleton Markers, Immunology, Neurodegeneration, Neuroscience, Signal Transduction
Gene ID (Entrez): 5533
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot, Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: PPP1R3F
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: HB2E, protein phosphatase 1 regulatory subunit 3F, protein phosphatase 1, regulatory subunit 3F, regulatory (inhibitor) subunit 3F
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein PPP1R3F using the following amino acid sequence: EVLQAPAIRIPPSSPLCGLGGSPRDQASGPDASEGATGPFLEPSQQQAEATWGVSSENGGGLEAVSGSEELLGEDTIDQELEQLYLSHLS
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 89801
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: PPAP2C
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: EC 3.1.3.4, LPP2PAP2-g, PAP2c, PAP-2clipid phosphate phosphohydrolase 2, PAP2-G, PAP2-gamma, Phosphatidate phosphohydrolase type 2c, Phosphatidic acid phosphatase 2c, phosphatidic acid phosphatase type 2C, phosphatidic acid phosphohydrolase type 2c, type-2 phosphatidic acid phosphatase-gamma
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein PPAP2C using the following amino acid sequence: PYKRGFYCGDDSIRYPYRPDTIT
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 8612
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
