DPH2 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB301654-Each-of-1 | In Stock | ₹ 45,731.82 |
NB301654 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 45,731.82
GST (18%): ₹ 8,231.728
Total Price: ₹ 53,963.548
Antigen
DPH2
Classification
Polyclonal
Dilution
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
diphthamide biosynthesis protein 2, Diphthamide biosynthesis protein 2 homolog-like 2, diptheria toxin resistance protein required for diphthamide biosynthesis-like 2, diptheria toxin resistance protein required for diphthamide biosynthesis-like 2(S. cerevisiae), DPH2 homolog, DPH2 homolog (S. cerevisiae), DPH2L2diphthamide biosynthesis-like protein 2, DPH2-like 2, DPH2-like 2 (S. cerevisiae), HsDph2
Immunogen
This antibody has been engineered to specifically recognize the recombinant protein DPH2 using the following amino acid sequence: DLGCERVALQFPDQLLGDAVAVAARLEETTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVAFVLRQRSVA
Quantity
100 μL
Research Discipline
Cell Cycle and Replication
Gene ID (Entrez)
1802
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, 40% glycerol
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- DPH2 Polyclonal antibody specifically detects DPH2 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: DPH2
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: diphthamide biosynthesis protein 2, Diphthamide biosynthesis protein 2 homolog-like 2, diptheria toxin resistance protein required for diphthamide biosynthesis-like 2, diptheria toxin resistance protein required for diphthamide biosynthesis-like 2(S. cerevisiae), DPH2 homolog, DPH2 homolog (S. cerevisiae), DPH2L2diphthamide biosynthesis-like protein 2, DPH2-like 2, DPH2-like 2 (S. cerevisiae), HsDph2
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein DPH2 using the following amino acid sequence: DLGCERVALQFPDQLLGDAVAVAARLEETTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVAFVLRQRSVA
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication
Gene ID (Entrez): 1802
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: Dopamine Receptor D4
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: D(2C) dopamine receptor, D(4) dopamine receptor, D4DR, Dopamine D4 receptor, dopamine receptor D4, seven transmembrane helix receptor
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Dopamine Receptor D4 using the following amino acid sequence: YSEVQGGAWLLSPRLCDALM
Quantity: 100 μL
Research Discipline: GPCR, Neuroscience
Gene ID (Entrez): 1815
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: Dnd1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias: dead end homolog 1 (zebrafish), dead end protein homolog 1, RBMS4MGC34750, RNA-binding motif, single-stranded-interacting protein 4
Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Dnd1 using the following amino acid sequence: MMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCELSVDGLPPNLTRSALLLALQPLGPGLQE
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 373863
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunocytochemistry
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, 40% glycerol
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
