Glucose Transporter GLUT6 Antibody, Biotin, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB358726-Each-of-1 | In Stock | ₹ 44,020.62 |
NB358726 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 44,020.62
GST (18%): ₹ 7,923.712
Total Price: ₹ 51,944.332
Antigen
Glucose Transporter GLUT6
Classification
Polyclonal
Dilution
Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Alias
Glucose transporter type 6, Glucose transporter type 9, GLUT6, GLUT-9, GLUT9GLUT-6, HSA011372, solute carrier family 2 (facilitated glucose transporter), member 6, solute carrier family 2, facilitated glucose transporter member 6
Immunogen
Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL The peptide sequence for this immunogen was taken from within the described region.
Quantity
0.1 mL
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Biotin
Formulation
PBS
Host Species
Rabbit
Purification Method
Protein A purified
Regulatory Status
RUO
Gene ID (Entrez)
11182
Content And Storage
Store at 4C in the dark.
Isotype
IgG
Related Products
Description
- Description Glucose Transporter GLUT6 Polyclonal antibody specifically detects Glucose Transporter GLUT6 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: Glucose Transporter GLUT6
Classification: Polyclonal
Dilution: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Alias: Glucose transporter type 6, Glucose transporter type 9, GLUT6, GLUT-9, GLUT9GLUT-6, HSA011372, solute carrier family 2 (facilitated glucose transporter), member 6, solute carrier family 2, facilitated glucose transporter member 6
Immunogen: Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL The peptide sequence for this immunogen was taken from within the described region.
Quantity: 0.1 mL
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Biotin
Formulation: PBS
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 11182
Content And Storage: Store at 4C in the dark.
Isotype: IgG
Antigen: Influenza A H7 Hemagglutinin
Classification: Monoclonal
Dilution: Western Blot, ELISA, Sandwich ELISA, Direct ELISA
Gene Alias: __
Immunogen: Hybridoma clone has been derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice immunized with Influenza A/Netherlands/219/03 (strain H7N7).
Quantity: 0.25 mL
Primary or Secondary: Primary
Target Species: Virus
Form: Purified
Applications: Western Blot, ELISA, Sandwich ELISA, Direct ELISA
Conjugate: Janelia Fluor 646
Formulation: 50mM Sodium Borate
Host Species: Mouse
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): __
Content And Storage: Store at 4C in the dark.
Isotype: IgG2b
Antigen: Influenza A H7 Hemagglutinin
Classification: Monoclonal
Dilution: Western Blot, ELISA, Sandwich ELISA, Direct ELISA
Gene Alias: __
Immunogen: Hybridoma clone has been derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice immunized with Influenza A/Netherlands/219/03 (strain H7N7).
Quantity: 0.25 mL
Primary or Secondary: Primary
Target Species: Virus
Form: Purified
Applications: Western Blot, ELISA, Sandwich ELISA, Direct ELISA
Conjugate: Janelia Fluor 549
Formulation: 50mM Sodium Borate
Host Species: Mouse
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): __
Content And Storage: Store at 4C in the dark.
Isotype: IgG2b
