DNAJB13 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB392907-Each-of-1 | In Stock | ₹ 32,683.92 |
NB392907 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
DNAJB13
Classification
Polyclonal
Dilution
Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Gene Alias
DnaJ (Hsp40) homolog, subfamily B, member 13,1700014P03Rik, DnaJ (Hsp40) related, subfamily B, member 13, dnaJ homolog subfamily B member 13, DnaJ-like protein, radial spoke 16 homolog A, RSPH16A, Testis and spermatogenesis cell-related protein 6, Testis spermatocyte apoptosis-related gene 6 protein, Testis spermatogenesis apoptosis-related gene 3 protein, Testis spermatogenesis apoptosis-related gene 6 protein, testis spermatogenesis apoptosis-related protein 6, TSARG3, TSARG5, TSARG6FLJ46748
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE
Quantity
25 μL
Research Discipline
Apoptosis
Gene ID (Entrez)
374407
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol
Host Species
Rabbit
Purification Method
Protein A purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- DNAJB13 Polyclonal antibody specifically detects DNAJB13 in Human samples
- It is validated for Immunocytochemistry/ Immunofluorescence
Compare Similar Items
Show Difference
Antigen: DNAJB13
Classification: Polyclonal
Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Gene Alias: DnaJ (Hsp40) homolog, subfamily B, member 13,1700014P03Rik, DnaJ (Hsp40) related, subfamily B, member 13, dnaJ homolog subfamily B member 13, DnaJ-like protein, radial spoke 16 homolog A, RSPH16A, Testis and spermatogenesis cell-related protein 6, Testis spermatocyte apoptosis-related gene 6 protein, Testis spermatogenesis apoptosis-related gene 3 protein, Testis spermatogenesis apoptosis-related gene 6 protein, testis spermatogenesis apoptosis-related protein 6, TSARG3, TSARG5, TSARG6FLJ46748
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE
Quantity: 25 μL
Research Discipline: Apoptosis
Gene ID (Entrez): 374407
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: TLX3
Classification: Polyclonal
Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Gene Alias: homeo box 11-like 2, HOX11L2MGC29804, RNXHomeobox protein Hox-11L2, T-cell leukemia homeobox 3, T-cell leukemia homeobox protein 3, T-cell leukemia, homeobox 3
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 30012
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: LCN9
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: lipocalin 9
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGSLIFDFEYMVQ
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 392399
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
