N acetyl transferase 5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB394384-Each-of-1 | In Stock | ₹ 32,683.92 |
NB394384 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
N acetyl transferase 5
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias
dJ1002M8.1, dJ1175I6.2 (N-terminal acetyltransferase complex ard1 subunit), EC 2.3.1.88, homolog), N(alpha)-acetyltransferase 20, NatB catalytic subunit, N-acetyltransferase 3 homolog, N-acetyltransferase 5, N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), N-acetyltransferase 5 (GCN5-related, putative), N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, N-alpha-acetyltransferase 20, NatB catalytic subunit, NAT3N-terminal acetyltransferase B complex catalytic subunit NAT5, NAT5dJ1002M8.1 (N-terminal acetyltransferase complex ard1 subunit), NatB complex subunit NAT5, N-terminal acetyltransferase B complex catalytic subunit NAA20, N-terminal acetyltransferase complex ARD1 subunit
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
51126
Target Species
Human
Form
Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
NAA20
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
Quantity
25 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype
IgG
Related Products
Description
- N acetyl transferase 5 Polyclonal specifically detects N acetyl transferase 5 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: N acetyl transferase 5
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: dJ1002M8.1, dJ1175I6.2 (N-terminal acetyltransferase complex ard1 subunit), EC 2.3.1.88, homolog), N(alpha)-acetyltransferase 20, NatB catalytic subunit, N-acetyltransferase 3 homolog, N-acetyltransferase 5, N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), N-acetyltransferase 5 (GCN5-related, putative), N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, N-alpha-acetyltransferase 20, NatB catalytic subunit, NAT3N-terminal acetyltransferase B complex catalytic subunit NAT5, NAT5dJ1002M8.1 (N-terminal acetyltransferase complex ard1 subunit), NatB complex subunit NAT5, N-terminal acetyltransferase B complex catalytic subunit NAA20, N-terminal acetyltransferase complex ARD1 subunit
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 51126
Target Species: Human
Form: Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NAA20
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Antigen: PAK4
Classification: Polyclonal
Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: EC 2.7.11, EC 2.7.11.1, KIAA1142, p21 protein (Cdc42/Rac)-activated kinase 4, p21(CDKN1A)-activated kinase 4, p21-activated kinase 4, PAK-4, protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs, serine/threonine-protein kinase PAK 4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10298
Target Species: Human
Form: Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PAK4
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RQWQSLIEESARRPKPLVDPACITSIQPGAPKTIVRGSKGAKDGALTLLLDEFENM
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Antigen: THAP8
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: FLJ32891, THAP domain containing 8, THAP domain-containing protein 8
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 199745
Target Species: Human
Form: Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: THAP8
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQPEVPAQQAQTGLGPVLGALQRRVRRLQRCQERHQAQLQALERLAQQLHGE
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
