SRRM2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB394869-Each-of-1 | In Stock | ₹ 32,683.92 |
NB394869 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
SRRM2
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Gene Alias
Cwc21, CWF21, DKFZp667L0421,300 kDa nuclear matrix antigen, DKFZp686O15166,300-KD, FLJ21926, FLJ22250, HSPC075, KIAA0324, MGC40295, RNA binding protein, ser/Arg-related nuclear matrix protein of 300 kDa, serine/arginine repetitive matrix 2, serine/arginine repetitive matrix protein 2, serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa, splicing coactivator subunit SRm300, SRL300, SRm300, SR-related nuclear matrix protein of 300 kDa, taxREB803, tax-responsive enhancer element-binding protein 803
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
23524
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SRRM2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQPAPEP
Quantity
25 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Related Products
Description
- SRRM2 Polyclonal specifically detects SRRM2 in Human, Mouse samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SRRM2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Gene Alias: Cwc21, CWF21, DKFZp667L0421,300 kDa nuclear matrix antigen, DKFZp686O15166,300-KD, FLJ21926, FLJ22250, HSPC075, KIAA0324, MGC40295, RNA binding protein, ser/Arg-related nuclear matrix protein of 300 kDa, serine/arginine repetitive matrix 2, serine/arginine repetitive matrix protein 2, serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa, splicing coactivator subunit SRm300, SRL300, SRm300, SR-related nuclear matrix protein of 300 kDa, taxREB803, tax-responsive enhancer element-binding protein 803
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 23524
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SRRM2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQPAPEP
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Antigen: FAM133A
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Gene Alias: Cancer/Testis Antigen 115, CT115, Family With Sequence Similarity 133 Member A, Family With Sequence Similarity 133, Member A, Protein FAM133A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 286499
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: FAM133A
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KALAEFEEKMNENWKKELEKSREKLLSG
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Antigen: CARF/CDKN2AIP
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Gene Alias: CARFCDKN2A-interacting protein, CDKN2A interacting protein, collaborates/cooperates with ARF (alternate reading frame) protein, Collaborator of ARF, FLJ20036
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 55602
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CDKN2AIP
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAK
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
