LMP7/PSMB8 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB396231-Each-of-1 | In Stock | ₹ 32,683.92 |
NB396231 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
LMP7/PSMB8
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
beta5i, D6S216E, EC 3.4.25.1, LMP7MGC1491, Low molecular mass protein 7, low molecular weight protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, protease component C13, proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalpeptidase 7), proteasome catalytic subunit 3i, Proteasome component C13, proteasome subunit beta 5i, proteasome subunit beta type-8, Proteasome subunit beta-5i, proteasome subunit Y2, proteasome-related gene 7, PSMB5iD6S216, Really interesting new gene 10 protein, RING10proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalprotease 7), Y2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
PSMB8
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RPNLSPEEAYDLGRRAIAYATHRDS
Quantity
25 μL
Research Discipline
Stem Cell Markers
Gene ID (Entrez)
5696
Target Species
Human
Isotype
IgG
Related Products
Description
- LMP7/PSMB8 Polyclonal specifically detects LMP7/PSMB8 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: LMP7/PSMB8
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: beta5i, D6S216E, EC 3.4.25.1, LMP7MGC1491, Low molecular mass protein 7, low molecular weight protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, protease component C13, proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalpeptidase 7), proteasome catalytic subunit 3i, Proteasome component C13, proteasome subunit beta 5i, proteasome subunit beta type-8, Proteasome subunit beta-5i, proteasome subunit Y2, proteasome-related gene 7, PSMB5iD6S216, Really interesting new gene 10 protein, RING10proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalprotease 7), Y2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: PSMB8
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RPNLSPEEAYDLGRRAIAYATHRDS
Quantity: 25 μL
Research Discipline: Stem Cell Markers
Gene ID (Entrez): 5696
Target Species: Human
Isotype: IgG
Antigen: MCCD1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: MCCD1, Mitochondrial coiled-coil domain protein 1, Precursor
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: MCCD1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQ
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 401250
Target Species: Human
Isotype: IgG
Antigen: MEF2BNB
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: MADS Box Transcription Enhancer Factor 2, Polypeptide B (Myocyte Enhancer Factor 2B), myocyte enhancer factor 2B, Myocyte-Specific Enhancer Factor 2B, RSRFR2, Serum Response Factor-Like Protein 2, XMEF2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: MEF2BNB
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQS
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 729991
Target Species: Human
Isotype: IgG
