Classification:
Polyclonal
Dilution:
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias:
40 kDa SR-repressor protein, FLJ43846, FUS interacting protein (serine-arginine rich) 1, FUS-interacting protein (serine-arginine rich) 2, FUS-interacting serine-arginine-rich protein 1, FUSIP1DKFZp686H0644, FUSIP2, neural-salient SR protein, NSSR, serine/arginine-rich splicing factor 10, serine-arginine repressor protein (40 kDa), SFRS13, SFRS13A, Splicing factor SRp38, splicing factor, arginine/serine-rich 13, Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats, SR splicing factor 10, SRp38, SRrp40TLS-associated protein with SR repeats, TASR1TLS-associated SR protein, TASR2FUS interacting protein (serine/arginine-rich) 1, TASRFLJ30749, TLS-associated protein TASR, TLS-associated serine-arginine protein, TLS-associated serine-arginine protein 1, TLS-associated serine-arginine protein 2
Immunogen:
This antibody was developed against Recombinant Protein corresponding to amino acids: QPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQS
Primary or Secondary:
Primary
Applications:
Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Formulation:
PBS (pH 7.2), 40% Glycerol
Purification Method:
Immunogen affinity purified
Content And Storage:
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.