PP2A alpha Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB396356-Each-of-1 | In Stock | ₹ 32,683.92 |
NB396356 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
PP2A alpha
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
EC 3.1.3.16, PP2A-alpha, PP2Ac, PP2CA, PP2Calpha, protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform, protein phosphatase 2, catalytic subunit, alpha isozyme, protein phosphatase 2A catalytic subunit, alpha isoform, Replication protein C, RP-C, serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF
Quantity
25 μL
Research Discipline
Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Neuronal Cell Markers, Neurotransmission, Protein Phosphatase, Signal Transduction
Gene ID (Entrez)
5515
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2), 40% Glycerol
Host Species
Rabbit
Purification Method
Immunogen affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Form
Purified
Related Products
Description
- PP2A alpha Polyclonal antibody specifically detects PP2A alpha in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: PP2A alpha
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: EC 3.1.3.16, PP2A-alpha, PP2Ac, PP2CA, PP2Calpha, protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform, protein phosphatase 2, catalytic subunit, alpha isozyme, protein phosphatase 2A catalytic subunit, alpha isoform, Replication protein C, RP-C, serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF
Quantity: 25 μL
Research Discipline: Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Neuronal Cell Markers, Neurotransmission, Protein Phosphatase, Signal Transduction
Gene ID (Entrez): 5515
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2), 40% Glycerol
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Purified
Antigen: ZSCAN5
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: MGC4161, zinc finger and SCAN domain containing 5, zinc finger and SCAN domain containing 5A, zinc finger and SCAN domain-containing protein 5A, Zinc finger protein 495ZSCAN5, ZNF495
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NVDADTPSACVVEREASTHSGNRGDALNL
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 79149
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2), 40% Glycerol
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: LRRC37A
Classification: Polyclonal
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: Leucine Rich Repeat Containing 37A, Leucine-Rich Repeat-Containing Protein 37A, LRRC37, LRRC37A1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PGQPPEHHEVTVSPPGHHQTHHLASPSVSVKPPDVQLTIAAEPSAEVGTSLVHQEATTRLSGSGNDVEPPAIQHGGPPLLPESSEE
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 9884
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2), 40% Glycerol
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
