EpCAM/TROP1 Antibody (CL6259), Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB402774-Each-of-1 | In Stock | ₹ 32,683.92 |
NB402774 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
EpCAM/TROP1
Classification
Monoclonal
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Symbols
EPCAM
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NGSKLGRRAKPEGALQNND
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG3
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Clone
CL6259
Dilution
Western Blot 1 μg/mL, Immunohistochemistry 1:200-1:500, Immunohistochemistry-Paraffin 1:200-1:500, Knockdown Validated
Gene Alias
17-1A, 323/A3, ACSTD1, antigen identified by monoclonal AUA1, CD326 antigen, Cell surface glycoprotein Trop-1, chromosome 4, surface marker (35kD glycoprotein), DIAR5, EGP, EGP-2, EGP314, EGP40, EpCAM, epithelial cell adhesion molecule, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, ESA, GA733-2EGP34, hEGP314, HNPCC8, KS 1/4 antigen, KS1/4, KSAHEA125, M1S2, M4S1Ly74, Major gastrointestinal tumor-associated protein GA733-2, MIC18MH99, MOC31, TACST-1, TACSTD1, TROP1CD326, Tumor-associated calcium signal transducer 1CO-17A
Host Species
Mouse
Quantity
25 μL
Research Discipline
Cancer, Cancer Stem Cells, Tumor Biomarkers
Gene ID (Entrez)
4072
Target Species
Human
Form
Purified
Related Products
Description
- EpCAM/TROP1 Monoclonal specifically detects EpCAM/TROP1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.
Compare Similar Items
Show Difference
Antigen: EpCAM/TROP1
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Symbols: EPCAM
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NGSKLGRRAKPEGALQNND
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG3
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Clone: CL6259
Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:200-1:500, Immunohistochemistry-Paraffin 1:200-1:500, Knockdown Validated
Gene Alias: 17-1A, 323/A3, ACSTD1, antigen identified by monoclonal AUA1, CD326 antigen, Cell surface glycoprotein Trop-1, chromosome 4, surface marker (35kD glycoprotein), DIAR5, EGP, EGP-2, EGP314, EGP40, EpCAM, epithelial cell adhesion molecule, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, ESA, GA733-2EGP34, hEGP314, HNPCC8, KS 1/4 antigen, KS1/4, KSAHEA125, M1S2, M4S1Ly74, Major gastrointestinal tumor-associated protein GA733-2, MIC18MH99, MOC31, TACST-1, TACSTD1, TROP1CD326, Tumor-associated calcium signal transducer 1CO-17A
Host Species: Mouse
Quantity: 25 μL
Research Discipline: Cancer, Cancer Stem Cells, Tumor Biomarkers
Gene ID (Entrez): 4072
Target Species: Human
Form: Purified
Antigen: Integrin alpha 2/CD49b
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Symbols: ITGA2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG1
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Clone: CL7318
Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: alpha-2 subunit, CD49b antigen, integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor), VLA 2
Host Species: Mouse
Quantity: 25 μL
Research Discipline: Cellular Markers, Innate Immunity, Signal Transduction
Gene ID (Entrez): 3673.0
Target Species: Human
Form: Purified
Antigen: RTEL1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol
Gene Symbols: __
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVT
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunofluorescence
Clone: __
Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Gene Alias: C20orf41, regulator of telomere elongation helicase 1, regulator of telomere length
Host Species: Rabbit
Quantity: 25 μL
Research Discipline: Cancer, DNA Repair
Gene ID (Entrez): 51750
Target Species: Human
Form: Purified
