PI 3-Kinase p110 gamma Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB403568-Each-of-1 | In Stock | ₹ 32,683.92 |
NB403568 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
PI 3-Kinase p110 gamma
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias
1-phosphatidylinositol 3-kinase, EC 2.7.1, EC 2.7.1.153, p110-gamma, p120-PI3K, phosphatidylinositol 3 kinase gamma, p110 gamma, phosphatidylinositol 3-kinase catalytic 110-kD gamma, phosphatidylinositol 3-kinase, catalytic, gamma polypeptide, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform, phosphoinositide-3-kinase gamma catalytic subunit, phosphoinositide-3-kinase, catalytic, gamma polypeptide, PI3CG, PI3K, PI3Kgamma, PI3K-gamma, PI3-kinase subunit gamma, PIK3, PtdIns-3-kinase subunit gamma, PtdIns-3-kinase subunit p110-gamma
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PIK3CG
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT
Quantity
25 μL
Research Discipline
mTOR Pathway, Signal Transduction
Gene ID (Entrez)
5294
Target Species
Human
Form
Purified
Related Products
Description
- PI 3-Kinase p110 gamma Polyclonal specifically detects PI 3-Kinase p110 gamma in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PI 3-Kinase p110 gamma
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: 1-phosphatidylinositol 3-kinase, EC 2.7.1, EC 2.7.1.153, p110-gamma, p120-PI3K, phosphatidylinositol 3 kinase gamma, p110 gamma, phosphatidylinositol 3-kinase catalytic 110-kD gamma, phosphatidylinositol 3-kinase, catalytic, gamma polypeptide, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform, phosphoinositide-3-kinase gamma catalytic subunit, phosphoinositide-3-kinase, catalytic, gamma polypeptide, PI3CG, PI3K, PI3Kgamma, PI3K-gamma, PI3-kinase subunit gamma, PIK3, PtdIns-3-kinase subunit gamma, PtdIns-3-kinase subunit p110-gamma
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PIK3CG
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT
Quantity: 25 μL
Research Discipline: mTOR Pathway, Signal Transduction
Gene ID (Entrez): 5294
Target Species: Human
Form: Purified
Antigen: SPTY2D1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: SPTY2D1 SPT2, Suppressor of Ty, domain containing 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SPTY2D1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGPGRSISGSIPAGRTVSNSVPGRPVSSLGPGQTVSSSGPTIKPKCTVVSETISSKNIISRSSNGQMNGMKPPLSGYRAAQGPQRLPFPTGYKRQREYEE
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 144108
Target Species: Human
Form: Purified
Antigen: Lhx4
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: CPHD4, FLJ22769, Gsh4, LIM homeobox 4, LIM homeobox protein 4, LIM/homeobox protein Lhx4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: LHX4
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSF
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 89884
Target Species: Human
Form: Purified
