ST6GALNAC3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB403626-Each-of-1 | In Stock | ₹ 32,683.92 |
NB403626 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
ST6GALNAC3
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3, alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III, EC 2.4.99.-, EC 2.4.99.7, FLJ13669, FLJ27239, GalNAc alpha-2,6-sialyltransferase III, PRO7177, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) C, Sialyltransferase 7C, SIAT7C, SIAT7-C, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltran, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 3, ST6GalNAc III, ST6GALNACIII, STY
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
256435
Target Species
Human
Form
Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ST6GALNAC3
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGS
Quantity
25 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype
IgG
Related Products
Description
- ST6GALNAC3 Polyclonal specifically detects ST6GALNAC3 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ST6GALNAC3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3, alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III, EC 2.4.99.-, EC 2.4.99.7, FLJ13669, FLJ27239, GalNAc alpha-2,6-sialyltransferase III, PRO7177, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) C, Sialyltransferase 7C, SIAT7C, SIAT7-C, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltran, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 3, ST6GalNAc III, ST6GALNACIII, STY
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 256435
Target Species: Human
Form: Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ST6GALNAC3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGS
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Antigen: E2F-1
Classification: Polyclonal
Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: E2F transcription factor 1, E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, Retinoblastoma-associated protein 1, Retinoblastoma-binding protein 3, transcription factor E2F1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 1869
Target Species: Human
Form: Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: E2F1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
Antigen: ZNF57
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias: Zinc finger protein 424ZNF424, zinc finger protein 57
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 126295
Target Species: Human
Form: Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ZNF57
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TGQKSHECQSYSKAFSCQVILSKTSESTH
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype: IgG
