UBA3 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB404292-Each-of-1 | In Stock | ₹ 32,683.92 |
NB404292 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
UBA3
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
DKFZp566J164, EC 6.3.2, EC 6.3.2.-, hUba3, MGC22384, NEDD8-activating enzyme E1 catalytic subunit, NEDD8-activating enzyme E1C, Nedd8-activating enzyme hUba3, UBA3, ubiquitin-activating enzyme E1 homolog, UBE1C, Ubiquitin-activating enzyme 3, Ubiquitin-activating enzyme E1C, ubiquitin-activating enzyme E1C (homologous to yeast UBA3), ubiquitin-like modifier activating enzyme 3, Ubiquitin-like modifier-activating enzyme 3, yeast)
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLE
Quantity
25 μL
Research Discipline
Apoptosis, Cell Cycle and Replication, Neuroscience
Gene ID (Entrez)
9039
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2), 40% Glycerol
Host Species
Rabbit
Purification Method
Immunogen affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- UBA3 Polyclonal antibody specifically detects UBA3 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: UBA3
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: DKFZp566J164, EC 6.3.2, EC 6.3.2.-, hUba3, MGC22384, NEDD8-activating enzyme E1 catalytic subunit, NEDD8-activating enzyme E1C, Nedd8-activating enzyme hUba3, UBA3, ubiquitin-activating enzyme E1 homolog, UBE1C, Ubiquitin-activating enzyme 3, Ubiquitin-activating enzyme E1C, ubiquitin-activating enzyme E1C (homologous to yeast UBA3), ubiquitin-like modifier activating enzyme 3, Ubiquitin-like modifier-activating enzyme 3, yeast)
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLE
Quantity: 25 μL
Research Discipline: Apoptosis, Cell Cycle and Replication, Neuroscience
Gene ID (Entrez): 9039
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2), 40% Glycerol
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: RPL37A
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: 60S ribosomal protein L37a, MGC74786, ribosomal protein L37a
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KMKRRAVGIWHCGSCVKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 6168
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2), 40% Glycerol
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: SAMD4A
Classification: Polyclonal
Dilution: Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Gene Alias: DKFZp434H0350, DKFZp686A1532, hSmaug1DKFZP434H0350, KIAA1053SMAUG1, protein Smaug homolog 1, SAM domain-containing protein 4A, SAMD4, Smaug, Smaug 1, smaug homolog, Smaug1, SMG, SMGA, sterile alpha motif domain containing 4, sterile alpha motif domain containing 4A, Sterile alpha motif domain-containing protein 4A
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQN
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 23034
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2), 40% Glycerol
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
