HSD3B1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB404572-Each-of-1 | In Stock | ₹ 32,683.92 |
NB404572 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
HSD3B1
Classification
Polyclonal
Dilution
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
P26439
Host Species
Rabbit
Purification Method
Immunogen affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2), 40% Glycerol
Gene Alias
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I, 3BETAHSD, 3-beta-HSD I, 3-beta-hydroxy-Delta(5)-steroid dehydrogenase, 3BH, delta-5-3-ketosteroid isomerase, EC 1.1.1, HSD3B, HSDB3, HSDB3A, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1, I, progesterone reductase, SDR11E1, short chain dehydrogenase/reductase family 11E, member 1,3-beta-hydroxy-5-ene steroid dehydrogenase, steroid Delta-isomerase, Trophoblast antigen FDO161G
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLE
Quantity
25 μL
Research Discipline
Cancer, Lipid and Metabolism, Prostate Cancer, Signal Transduction
Gene ID (Entrez)
3283
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Related Products
Description
- HSD3B1 Polyclonal antibody specifically detects HSD3B1 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: HSD3B1
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: P26439
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2), 40% Glycerol
Gene Alias: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I, 3BETAHSD, 3-beta-HSD I, 3-beta-hydroxy-Delta(5)-steroid dehydrogenase, 3BH, delta-5-3-ketosteroid isomerase, EC 1.1.1, HSD3B, HSDB3, HSDB3A, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1, I, progesterone reductase, SDR11E1, short chain dehydrogenase/reductase family 11E, member 1,3-beta-hydroxy-5-ene steroid dehydrogenase, steroid Delta-isomerase, Trophoblast antigen FDO161G
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLE
Quantity: 25 μL
Research Discipline: Cancer, Lipid and Metabolism, Prostate Cancer, Signal Transduction
Gene ID (Entrez): 3283
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: NBPF3
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: __
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2), 40% Glycerol
Gene Alias: AE2, Neuroblastoma Breakpoint Family Member 3, Neuroblastoma Breakpoint Family, Member 3, Protein AE2, Protein SHIIIa4
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VDIGRHRWDQVKKEDQEATGPRLSRELLD
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 84224
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: RABL2A
Classification: Polyclonal
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q9UBK7
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2), 40% Glycerol
Gene Alias: FLJ78724, MGC117180, RAB, member of RAS oncogene family-like 2A, rab-like protein 2A
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPS
Quantity: 25 μL
Research Discipline: Signal Transduction
Gene ID (Entrez): 11159
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
