DBT Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB430625-Each-of-1 | In Stock | ₹ 32,683.92 |
NB430625 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
DBT
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
BCATE2BCKAD E2 subunit, BCKADE2, BCKAD-E2, branched chain acyltransferase, E2 component, Branched-chain alpha-keto acid dehydrogenase complex component E2, Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, Dihydrolipoamide branched chain transacylase, dihydrolipoamide branched chain transacylase (E2 component of branched chainketo acid dehydrogenase complex; maple syrup urine disease), dihydrolipoamide branched chain transacylase E2, dihydrolipoyl transacylase, Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase, E2, E2 component of branched chain alpha-keto acid dehydrogenase complex, E2B, EC 2.3.1.168, lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, mitochondrial, lipoamide acyltransferase component of mitochondrial branched-chain alpha-ketoacid dehydrogenase complex, MGC9061, mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit(E2b)
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of human DBT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
DBT
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQ
Quantity
25 μL
Research Discipline
Stem Cell Markers
Gene ID (Entrez)
1629
Target Species
Human, Mouse, Rat
Isotype
IgG
Related Products
Description
- DBT Polyclonal specifically detects DBT in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: DBT
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: BCATE2BCKAD E2 subunit, BCKADE2, BCKAD-E2, branched chain acyltransferase, E2 component, Branched-chain alpha-keto acid dehydrogenase complex component E2, Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, Dihydrolipoamide branched chain transacylase, dihydrolipoamide branched chain transacylase (E2 component of branched chainketo acid dehydrogenase complex; maple syrup urine disease), dihydrolipoamide branched chain transacylase E2, dihydrolipoyl transacylase, Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase, E2, E2 component of branched chain alpha-keto acid dehydrogenase complex, E2B, EC 2.3.1.168, lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, mitochondrial, lipoamide acyltransferase component of mitochondrial branched-chain alpha-ketoacid dehydrogenase complex, MGC9061, mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit(E2b)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of human DBT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: DBT
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQ
Quantity: 25 μL
Research Discipline: Stem Cell Markers
Gene ID (Entrez): 1629
Target Species: Human, Mouse, Rat
Isotype: IgG
Antigen: NUDC
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Gene Alias: HNUDC, MNUDC, NPD011, nuclear distribution gene C (A.nidulans) homolog, nuclear distribution gene C homolog (A. nidulans), Nuclear distribution protein C homolog, nuclear migration protein nudC, NudC
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: NUDC
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWT
Quantity: 25 μL
Research Discipline: Cell Cycle and Replication
Gene ID (Entrez): 10726
Target Species: Human, Mouse, Rat
Isotype: IgG
Antigen: MDH1
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: cytoplasmic, Cytosolic malate dehydrogenase, malate dehydrogenase 1, NAD (soluble), MDHA, MDH-s, MGC:1375, MOR2, soluble malate dehydrogenase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of human MDH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: MDH1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVA
Quantity: 25 μL
Research Discipline: __
Gene ID (Entrez): 4190
Target Species: Human, Mouse, Rat
Isotype: IgG
