JWA Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB432723-Each-of-1 | In Stock | ₹ 32,683.92 |
NB432723 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
JWA
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Gene Alias
ADP-ribosylation factor-like protein 6-interacting protein 5, ADP-ribosylation-like factor 6 interacting protein 5, Aip-5, ARL-6-interacting protein 5, Cytoskeleton-related vitamin A-responsive protein, Dermal papilla-derived protein 11, DERP11addicsin, Glutamate transporter EAAC1-interacting protein, glutamate transporter EEAC1-associated protein, GTRAP3-18aip-5, hp22, HSPC127, JM5, jmx, JWAcytoskeleton related vitamin A responsive protein, PRA1 domain family 3, PRA1 family protein 3, PRA2, PRAF3dermal papilla derived protein 11, Prenylated Rab acceptor protein 2, Protein JWa, putative MAPK activating protein PM27, Putative MAPK-activating protein PM27
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
10550
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
ARL6IP5
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
Quantity
25 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- JWA Polyclonal specifically detects JWA in Human, Mouse samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: JWA
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Gene Alias: ADP-ribosylation factor-like protein 6-interacting protein 5, ADP-ribosylation-like factor 6 interacting protein 5, Aip-5, ARL-6-interacting protein 5, Cytoskeleton-related vitamin A-responsive protein, Dermal papilla-derived protein 11, DERP11addicsin, Glutamate transporter EAAC1-interacting protein, glutamate transporter EEAC1-associated protein, GTRAP3-18aip-5, hp22, HSPC127, JM5, jmx, JWAcytoskeleton related vitamin A responsive protein, PRA1 domain family 3, PRA1 family protein 3, PRA2, PRAF3dermal papilla derived protein 11, Prenylated Rab acceptor protein 2, Protein JWa, putative MAPK activating protein PM27, Putative MAPK-activating protein PM27
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10550
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: ARL6IP5
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: DERP13
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: C7orf10, CaiB/baiF CoA-transferase family protein C7orf10, chromosome 7 open reading frame 10, Dermal papilla-derived protein 13, DERP13, DERP13FLJ11808, EC 2.-, FLJ53872, ORF19, Russel-Silver syndrome candidate
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 79783
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: SUGCT
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HAMLATLARVAALRRTCLFSGRGGGRGLWTGRPQSDMNNIKPLEGVKILDLTRVLAGPFATMNLGDLGAEVIKVERPGAGDDTRTW
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: DERP13
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: C7orf10, CaiB/baiF CoA-transferase family protein C7orf10, chromosome 7 open reading frame 10, Dermal papilla-derived protein 13, DERP13, DERP13FLJ11808, EC 2.-, FLJ53872, ORF19, Russel-Silver syndrome candidate
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 79783
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: SUGCT
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KGVKIIKELAAVCDVFVENYVPGKLSAMGLGYEDIDEIAPHIIYCSITGYGQTGPISQRAGYDAVASAVSGLMHITGPENGDPVRPGVAMTDLATGLYAYGAIMAGLIQKYKTGKGLFIDCNLLS
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
