ST3GAL3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB438549-Each-of-1 | In Stock | ₹ 32,683.92 |
NB438549 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,683.92
GST (18%): ₹ 5,883.106
Total Price: ₹ 38,567.026
Antigen
ST3GAL3
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
alpha 2,3-sialyltransferase III, Alpha 2,3-ST 3, alpha-2,3-sialyltransferase II, Beta-galactoside alpha-2,3-sialyltransferase 3, CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase, EC 2.4.99.6, Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase, Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase, N-acetyllactosaminide alpha-2,3-sialyltransferase, Sialyltransferase 6, SIAT6sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase), ST3 beta-galactoside alpha-2,3-sialyltransferase 3, ST3Gal III, ST3GALII, ST3GalIII, ST3N
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
6487
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
ST3GAL3
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIF
Quantity
25ul
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ST3GAL3 Polyclonal specifically detects ST3GAL3 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ST3GAL3
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: alpha 2,3-sialyltransferase III, Alpha 2,3-ST 3, alpha-2,3-sialyltransferase II, Beta-galactoside alpha-2,3-sialyltransferase 3, CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase, EC 2.4.99.6, Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase, Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase, N-acetyllactosaminide alpha-2,3-sialyltransferase, Sialyltransferase 6, SIAT6sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase), ST3 beta-galactoside alpha-2,3-sialyltransferase 3, ST3Gal III, ST3GALII, ST3GalIII, ST3N
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 6487
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: ST3GAL3
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIF
Quantity: 25ul
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: SFRS4
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: Pre-mRNA-splicing factor SRP75, serine/arginine-rich splicing factor 4, SFRS4, Splicing factor, arginine/serine-rich 4SRP001LB, SRP75SR splicing factor 4
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 6429
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol
Gene Symbols: __
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVSKEREHAKSESSQREGRGESENAGTNQETRSR
Quantity: 25 μL
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: SRrp35
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: 35 kDa SR repressor protein, FLJ14459, serine/arginine-rich splicing factor 12, serine-arginine repressor protein (35 kDa), SFRS13B, SFRS19FLJ41221, Splicing factor, arginine/serine-rich 13BFLJ33484, Splicing factor, arginine/serine-rich 19, SR splicing factor 12, SRRP35, SRrp35RP11-63L7.3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 135295
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: SRSF12
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RSTSARQSRTPRRNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARS
Quantity: 25ul
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
