Manufacturer: Novus Biologicals
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP152823-Each-of-1 | In Stock | ₹ 43,387.50 |
NBP152823 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 43,387.50
GST (18%): ₹ 7,809.75
Total Price: ₹ 51,197.25
SF-1/NR5A1/Steroidogenic Factor 1
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
AD4BPSTF-1, Adrenal 4-binding protein, ELP, FTZ1adrenal 4 binding protein, FTZF1nuclear receptor AdBP4, Fushi tarazu factor homolog 1, Nuclear receptor subfamily 5 group A member 1, nuclear receptor subfamily 5, group A, member 1, SF-1POF7, SF1steroidogenic factor 1, Steroid hormone receptor Ad4BP, steroidogenic factor-1
Rabbit
52 kDa
100 μL
Primary
Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 90%; Canine: 85%; Pig: 84%; Rabbit: 78%.
Human, Mouse, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
IgG
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
0.5 mg/ml
Western Blot 1.0 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 4-8 ug/ml
Q13285
NR5A1
Synthetic peptides corresponding to SF1/Steroidogenic Factor 1 The peptide sequence was selected from the middle region of SF1/Steroidogenic Factor 1. Peptide sequence SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA.
Affinity purified
RUO
2516
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.