HADHB Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP154750-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP154750 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
HADHB
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
2-enoyl-Coenzyme A (CoA) hydratase, beta subunit, 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, acetyl-CoA acyltransferase, beta subunit, beta-ketothiolase, EC 2.3.1, EC 2.3.1.16, ECHB, hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit, hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit, hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, MGC87480, mitochondrial trifunctional enzyme, beta subunit, mitochondrial trifunctional protein, beta subunit, MTPB, TP-beta, trifunctional enzyme subunit beta, mitochondrial
Host Species
Rabbit
Molecular Weight of Antigen
47 kDa
Quantity
100 μL
Research Discipline
metabolism
Gene ID (Entrez)
3032
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.
P55084
Gene Symbols
HADHB
Immunogen
Synthetic peptides corresponding to HADHB(hydroxyacyl-Coenzyme A dehydrogenase (trifunctional protein), beta subunit) The peptide sequence was selected from the C terminal of HADHB. Peptide sequence LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE The peptide sequence for this immunogen was taken from within the described region.
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
This product is specific to Subunit or Isoform: beta, mitochondrial.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
Isotype
IgG
Related Products
Description
- HADHB Polyclonal specifically detects HADHB in Human, Mouse samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: HADHB
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit, 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, acetyl-CoA acyltransferase, beta subunit, beta-ketothiolase, EC 2.3.1, EC 2.3.1.16, ECHB, hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit, hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit, hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, MGC87480, mitochondrial trifunctional enzyme, beta subunit, mitochondrial trifunctional protein, beta subunit, MTPB, TP-beta, trifunctional enzyme subunit beta, mitochondrial
Host Species: Rabbit
Molecular Weight of Antigen: 47 kDa
Quantity: 100 μL
Research Discipline: metabolism
Gene ID (Entrez): 3032
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: P55084
Gene Symbols: HADHB
Immunogen: Synthetic peptides corresponding to HADHB(hydroxyacyl-Coenzyme A dehydrogenase (trifunctional protein), beta subunit) The peptide sequence was selected from the C terminal of HADHB. Peptide sequence LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE The peptide sequence for this immunogen was taken from within the described region.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: This product is specific to Subunit or Isoform: beta, mitochondrial.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
Isotype: IgG
Antigen: ME3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: EC 1.1.1, EC 1.1.1.40, FLJ34862, malate dehydrogenase, Malic enzyme 3, malic enzyme 3, NADP(+)-dependent, mitochondrial, malic enzyme, NADP+-dependent, mitochondrial, mitochondrial NADP(+)-dependent malic enzyme 3, NADP-dependent malic enzyme, mitochondrial, NADP-ME, pyruvic-malic carboxylase
Host Species: Rabbit
Molecular Weight of Antigen: 67 kDa
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 10873
Reconstitution: __
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q16798
Gene Symbols: ME3
Immunogen: Synthetic peptides corresponding to ME3(malic enzyme 3, NADP(+)-dependent, mitochondrial) The peptide sequence was selected from the N terminal of ME3. Peptide sequence PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Sheep, Zebrafish
Isotype: IgG
Antigen: Pyruvate Dehydrogenase E2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: 70 kDa mitochondrial autoantigen of primary biliary cirrhosis, dihydrolipoamide S-acetyltransferase, DLTA, E2 component of pyruvate dehydrogenase complex, EC 2.3.1, M2 antigen complex 70 kDa subunit, PBC, PDC-E2EC 2.3.1.12, PDCE2mitochondrial
Host Species: Rabbit
Molecular Weight of Antigen: 69 kDa
Quantity: 100 μL
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 1737
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q86YI5
Gene Symbols: DLAT
Immunogen: Synthetic peptides corresponding to DLAT(dihydrolipoamide S-acetyltransferase) The peptide sequence was selected from the C terminal of DLAT. Peptide sequence DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat, Porcine, Canine, Zebrafish
Isotype: IgG
