NLRP1/NALP1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP154899-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP154899 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
NLRP1/NALP1
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
CARD7SLEV1, Caspase recruitment domain-containing protein 7, CLR17.1, Death effector filament-forming ced-4-like apoptosis protein, DEFCAPVAMAS1, DKFZp586O1822, KIAA0926DEFCAP-L/S, NACHT, leucine rich repeat and PYD (pyrin domain) containing 1, NACHT, leucine rich repeat and PYD containing 1, NACHT, LRR and PYD containing protein 1, NACHT, LRR and PYD domains-containing protein 1, NACPP1044, NALP1caspase recruitment domain protein 7, NLR family, pyrin domain containing 1, Nucleotide-binding domain and caspase recruitment domain, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1
Host Species
Rabbit
Molecular Weight of Antigen
155 kDa
Quantity
100 μL
Research Discipline
Apoptosis
Gene ID (Entrez)
22861
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500
Gene Accession No.
Q9C000
Gene Symbols
NLRP1
Immunogen
Synthetic peptides corresponding to NLRP1(NLR family, pyrin domain containing 1) The peptide sequence was selected from the N terminal of NLRP1 (NP_001028225). DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL.
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- NLRP1/NALP1 Polyclonal specifically detects NLRP1/NALP1 in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen.
Compare Similar Items
Show Difference
Antigen: NLRP1/NALP1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: CARD7SLEV1, Caspase recruitment domain-containing protein 7, CLR17.1, Death effector filament-forming ced-4-like apoptosis protein, DEFCAPVAMAS1, DKFZp586O1822, KIAA0926DEFCAP-L/S, NACHT, leucine rich repeat and PYD (pyrin domain) containing 1, NACHT, leucine rich repeat and PYD containing 1, NACHT, LRR and PYD containing protein 1, NACHT, LRR and PYD domains-containing protein 1, NACPP1044, NALP1caspase recruitment domain protein 7, NLR family, pyrin domain containing 1, Nucleotide-binding domain and caspase recruitment domain, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1
Host Species: Rabbit
Molecular Weight of Antigen: 155 kDa
Quantity: 100 μL
Research Discipline: Apoptosis
Gene ID (Entrez): 22861
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500
Gene Accession No.: Q9C000
Gene Symbols: NLRP1
Immunogen: Synthetic peptides corresponding to NLRP1(NLR family, pyrin domain containing 1) The peptide sequence was selected from the N terminal of NLRP1 (NP_001028225). DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: LYRM1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: A211C6.1, LYR motif containing 1, LYR motif-containing protein 1
Host Species: Rabbit
Molecular Weight of Antigen: 14 kDa
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 57149
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: O43325
Gene Symbols: LYRM1
Immunogen: Synthetic peptides corresponding to LYRM1(LYR motif containing 1) The peptide sequence was selected from the middle region of LYRM1. Peptide sequence KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: MYLIP
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: band 4.1 superfamily member BZF1, BZF1, cellular modulator of immune recognition (c-MIR), EC 6.3.2.-, Idol, IDOLmyosin regulatory light chain-interacting protein, Inducible degrader of the LDL-receptor, MIRE3 ubiquitin-protein ligase MYLIP, myosin regulatory light chain interacting proteinE3 ubiquitin ligase-inducible degrader of the low density lipoprotein receptor
Host Species: Rabbit
Molecular Weight of Antigen: 50 kDa
Quantity: 100 μL
Research Discipline: Lipid and Metabolism, Zinc Finger
Gene ID (Entrez): 29116
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q8WY64
Gene Symbols: MYLIP
Immunogen: Synthetic peptides corresponding to MYLIP(myosin regulatory light chain interacting protein) The peptide sequence was selected from the middle region of MYLIP. Peptide sequence CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
