ATP6V1A Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP155212-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP155212 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
ATP6V1A
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
70kD, isoform 1, ATP6A1, ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1, ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide, ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A, EC 3.6.3, EC 3.6.3.14, H(+)-transporting two-sector ATPase, subunit A, H+-transporting ATPase chain A, vacuolar (VA68 type), HO68, VA68, vacuolar ATP synthase catalytic subunit A, ubiquitous isoform, Vacuolar ATPase isoform VA68, vacuolar proton pump alpha subunit 1, Vacuolar proton pump subunit alpha, V-ATPase 69 kDa subunit, V-ATPase 69 kDa subunit 1, V-ATPase A subunit 1, V-ATPase subunit A, Vma1, VPP2, V-type proton ATPase catalytic subunit A
Host Species
Rabbit
Molecular Weight of Antigen
68 kDa
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
This product is specific to Subunit or Isoform: A.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype
IgG
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
P38606
Gene Symbols
ATP6V1A
Immunogen
Synthetic peptides corresponding to ATP6V1A(ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A) The peptide sequence was selected from the N terminal of ATP6V1A. Peptide sequence SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR.
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
523
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ATP6V1A Polyclonal specifically detects ATP6V1A in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: ATP6V1A
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: 70kD, isoform 1, ATP6A1, ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1, ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide, ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A, EC 3.6.3, EC 3.6.3.14, H(+)-transporting two-sector ATPase, subunit A, H+-transporting ATPase chain A, vacuolar (VA68 type), HO68, VA68, vacuolar ATP synthase catalytic subunit A, ubiquitous isoform, Vacuolar ATPase isoform VA68, vacuolar proton pump alpha subunit 1, Vacuolar proton pump subunit alpha, V-ATPase 69 kDa subunit, V-ATPase 69 kDa subunit 1, V-ATPase A subunit 1, V-ATPase subunit A, Vma1, VPP2, V-type proton ATPase catalytic subunit A
Host Species: Rabbit
Molecular Weight of Antigen: 68 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: This product is specific to Subunit or Isoform: A.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: P38606
Gene Symbols: ATP6V1A
Immunogen: Synthetic peptides corresponding to ATP6V1A(ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A) The peptide sequence was selected from the N terminal of ATP6V1A. Peptide sequence SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 523
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: Sterol carrier protein 2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: DKFZp686C12188, DKFZp686D11188, NLTP, non-specific lipid-transfer protein, NSL-TP, Propanoyl-CoA C-acyltransferase, SCP-2, SCP-CHI, SCPX, SCP-X, sterol carrier protein 2EC 2.3.1.176, Sterol carrier protein X
Host Species: Rabbit
Molecular Weight of Antigen: 35 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat, Equine, Guinea Pig, Zebrafish
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q6NXF4
Gene Symbols: SCP2
Immunogen: Synthetic peptides corresponding to SCP2(sterol carrier protein 2) The peptide sequence was selected from the middle region of SCP2 (NP_001007099). Peptide sequence NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 6342
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: CENPQ
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: C6orf139, CENP-QFLJ10545, centromere protein Q, chromosome 6 open reading frame 139
Host Species: Rabbit
Molecular Weight of Antigen: 30 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q7L2Z9
Gene Symbols: CENPQ
Immunogen: Synthetic peptides corresponding to CENPQ(centromere protein Q) The peptide sequence was selected from the N terminal of CENPQ. Peptide sequence VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 55166
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
