PUS10 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP156369-Each-of-1 | In Stock | ₹ 39,699.84 |
NBP156369 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 39,699.84
GST (18%): ₹ 7,145.971
Total Price: ₹ 46,845.811
Antigen
PUS10
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
Q3MIT2
Gene Symbols
PUS10
Immunogen
Synthetic peptides corresponding to PUS10 (pseudouridylate synthase 10) The peptide sequence was selected from the middle region of PUS10. Peptide sequence AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Guinea pig: 92%; Zebrafish: 85%.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype
IgG
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias
CCDC139, coiled-coil domain containing 139, Coiled-coil domain-containing protein 139, DOBIMGC126729, EC 5.4.99, EC 5.4.99.-, FLJ32312, MGC126755, pseudouridine synthase 10, pseudouridylate synthase 10, Psi55 synthase, PUS1, putative tRNA pseudouridine synthase Pus10, tRNA pseudouridine 55 synthase, tRNA pseudouridylate synthase, tRNA-uridine isomerase
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
150962
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at -20C. Avoid freeze-thaw cycles.
Description
- Description PUS10 Polyclonal specifically detects PUS10 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: PUS10
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q3MIT2
Gene Symbols: PUS10
Immunogen: Synthetic peptides corresponding to PUS10 (pseudouridylate synthase 10) The peptide sequence was selected from the middle region of PUS10. Peptide sequence AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Guinea pig: 92%; Zebrafish: 85%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: CCDC139, coiled-coil domain containing 139, Coiled-coil domain-containing protein 139, DOBIMGC126729, EC 5.4.99, EC 5.4.99.-, FLJ32312, MGC126755, pseudouridine synthase 10, pseudouridylate synthase 10, Psi55 synthase, PUS1, putative tRNA pseudouridine synthase Pus10, tRNA pseudouridine 55 synthase, tRNA pseudouridylate synthase, tRNA-uridine isomerase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 150962
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Antigen: ACTRT1
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q8TDG2
Gene Symbols: ACTRT1
Immunogen: Synthetic peptides corresponding to ACTRT1(actin-related protein T1) The peptide sequence was selected from the middle region of ACTRT1. Peptide sequence DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Canine: 85%; Bovine: 78%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: actin-related protein T1, AIP1, ARIP1, ARP-T1, ARPT1HSD27, KIAA0705, MGC26590
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 139741
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: C1orf55
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q6IQ49
Gene Symbols: SDE2
Immunogen: Synthetic peptide directed towards the C terminal of human C1orf55 (NP_689821). Peptide sequence AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: C1orf55, chromosome 1 open reading frame 55, dJ671D7.1, FLJ35382, hypothetical protein LOC163859, RP4-671D7.1, SDE2 telomere maintenance homolog (S. pombe)
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 163859
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.