XPG Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP156397-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP156397 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
XPG
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
COFS3, DNA excision repair protein ERCC-5, DNA repair protein complementing XP-G cells, EC 3.1, ERCM2, excision repair cross-complementing rodent repair deficiency, complementationgroup 5, excision repair protein, xeroderma pigmentosum complementation group G protein, Xeroderma pigmentosum group G-complementing protein, xeroderma pigmentosum, complementation group G, XPGC, XPG-complementing protein, XPGUVDR
Host Species
Rabbit
Molecular Weight of Antigen
133 kDa
Quantity
100 μL
Research Discipline
Cancer, DNA Repair, Nucleotide Excision Repair
Gene ID (Entrez)
2073
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
P28715
Gene Symbols
ERCC5
Immunogen
Synthetic peptide corresponding to the N terminal of ERCC5(excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G (Cockayne syndrome))) Peptide sequence NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ The peptide sequence for this immunogen was taken from within the described region.
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Pig: 92%; Xenopus: 85%; Bovine: 85%; Canine: 85%; Equine: 85%; Chicken: 78%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype
IgG
Description
- XPG Polyclonal specifically detects XPG in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: XPG
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: COFS3, DNA excision repair protein ERCC-5, DNA repair protein complementing XP-G cells, EC 3.1, ERCM2, excision repair cross-complementing rodent repair deficiency, complementationgroup 5, excision repair protein, xeroderma pigmentosum complementation group G protein, Xeroderma pigmentosum group G-complementing protein, xeroderma pigmentosum, complementation group G, XPGC, XPG-complementing protein, XPGUVDR
Host Species: Rabbit
Molecular Weight of Antigen: 133 kDa
Quantity: 100 μL
Research Discipline: Cancer, DNA Repair, Nucleotide Excision Repair
Gene ID (Entrez): 2073
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: P28715
Gene Symbols: ERCC5
Immunogen: Synthetic peptide corresponding to the N terminal of ERCC5(excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G (Cockayne syndrome))) Peptide sequence NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ The peptide sequence for this immunogen was taken from within the described region.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Pig: 92%; Xenopus: 85%; Bovine: 85%; Canine: 85%; Equine: 85%; Chicken: 78%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Antigen: ASPA
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: ACY-2, ACY2aminoacylase 2, Aminoacylase-2, ASPaminoacylase-2, aspartoacylase, aspartoacylase (aminoacylase 2, Canavan disease), EC 3.5.1.15
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 100 μL
Research Discipline: Neuroscience
Gene ID (Entrez): 443
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: P45381
Gene Symbols: ASPA
Immunogen: Synthetic peptides corresponding to ASPA(aspartoacylase (Canavan disease)) The peptide sequence was selected from the N terminal of ASPA. Peptide sequence RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: MAGEA3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Antigen MZ2-D, Cancer/testis antigen 1.3, CT1.3 MAGE-3 antigen, HIP8, MAGE3 MAGEA6, melanoma antigen family A, 3, melanoma-associated antigen 3, member 3, MGC14613
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 100 μL
Research Discipline: Cancer
Gene ID (Entrez): 4102
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml
Gene Accession No.: P43357
Gene Symbols: MAGEA3
Immunogen: Synthetic peptides corresponding to MAGEA3(melanoma antigen family A, 3) The peptide sequence was selected from the middle region of MAGEA3. Peptide sequence APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG