Manufacturer: Novus Biologicals
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP156816-Each-of-1 | In Stock | ₹ 43,387.50 |
NBP156816 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 43,387.50
GST (18%): ₹ 7,809.75
Total Price: ₹ 51,197.25
Calcineurin B
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
calcineurin subunit B type 1, CNA2, CNB1, Protein phosphatase 2B regulatory subunit 1, protein phosphatase 2B regulatory subunit B alpha, protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform(calcineurin B, type I), protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform(calcineurin B, type I), protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform, Protein phosphatase 3 regulatory subunit B alpha isoform 1, protein phosphatase 3, regulatory subunit B, alpha, type I (19kDa)
Rabbit
Affinity purified
RUO
Primary
This product is specific to Subunit or Isoform: B type 1.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
IgG
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
P63098
PPP3R1
Synthetic peptides corresponding to PPP3R1(protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform) The peptide sequence was selected from the N terminal of PPP3R1. Peptide sequence MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ The peptide sequence for this immunogen was taken from within the described region.
100 μL
Protein Phosphatase, Signal Transduction, Wnt Signaling Pathway
5534
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.