OSER1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP156864-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP156864 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
C20orf111
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
chromosome 20 open reading frame 111, dJ1183I21.1, HSPC207, Osr1, oxidative stress responsive 1, Perit1, peroxide-inducible transcript 1
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
51526
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
Q9NX31
Gene Symbols
C20ORF111
Immunogen
Synthetic peptides corresponding to C20ORF111 The peptide sequence was selected from the N terminal of C20ORF111. Peptide sequence RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Canine: 100%; Rat: 100%; Western clawed frog: 100%; Xenopus: 100%; Sumatran orangutan: 100%; Bovine: 100%; Mouse: 100%; Human: 100%; Chicken: 92%; Channel catfish: 92%; Green puffer: 92%; Zebrafish: 92%;.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype
IgG
Related Products
Description
- OSER1 Polyclonal specifically detects OSER1 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: C20orf111
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: chromosome 20 open reading frame 111, dJ1183I21.1, HSPC207, Osr1, oxidative stress responsive 1, Perit1, peroxide-inducible transcript 1
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 51526
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9NX31
Gene Symbols: C20ORF111
Immunogen: Synthetic peptides corresponding to C20ORF111 The peptide sequence was selected from the N terminal of C20ORF111. Peptide sequence RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Rat: 100%; Western clawed frog: 100%; Xenopus: 100%; Sumatran orangutan: 100%; Bovine: 100%; Mouse: 100%; Human: 100%; Chicken: 92%; Channel catfish: 92%; Green puffer: 92%; Zebrafish: 92%;.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: C20orf111
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: chromosome 20 open reading frame 111, dJ1183I21.1, HSPC207, Osr1, oxidative stress responsive 1, Perit1, peroxide-inducible transcript 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 51526
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: __
Dilution: Western Blot 1:100-1:2000
Gene Accession No.: Q9NX31
Gene Symbols: C20ORF111
Immunogen: Synthetic peptides corresponding to C20ORF111 The peptide sequence was selected from the N terminal of C20ORF111. Peptide sequence RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG.
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
Antigen: C2orf29
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: C40, chromosome 2 open reading frame 29, hypothetical protein LOC55571
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 55571
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9UKZ1
Gene Symbols: C2ORF29
Immunogen: Synthetic peptides corresponding to C2ORF29 The peptide sequence was selected from the N terminal of C2ORF29. Peptide sequence NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Pig: 100%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine
Isotype: IgG