Cytohesin 4 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP156913-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP156913 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
Cytohesin 4
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
CYT4PH, SEC7 and coiled-coil domain-containing protein 4, cytohesin 4, cytohesin-4, pleckstrin homology, Sec7 and coiled/coil domains 4, pleckstrin homology, Sec7 and coiled-coil domains 4, PSCD4DJ63G5.1
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
27128
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
Q9UIA0
Gene Symbols
CYTH4
Immunogen
Synthetic peptides corresponding to PSCD4(pleckstrin homology, Sec7 and coiled-coil domains 4) The peptide sequence was selected from the N terminal of PSCD4. Peptide sequence NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Pig: 100%; Bovine: 100%; Rat: 92%; Mouse: 92%; Western clawed frog: 90%; Xenopus: 90%; Zebrafish: 90%; Rainbow smelt: 90%; Atlantic salmon: 78%; Green puffer: 78%; Chicken: 78%; Green monkey: 78%; Human: 100%;.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype
IgG
Related Products
Description
- Cytohesin 4 Polyclonal specifically detects Cytohesin 4 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: Cytohesin 4
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: CYT4PH, SEC7 and coiled-coil domain-containing protein 4, cytohesin 4, cytohesin-4, pleckstrin homology, Sec7 and coiled/coil domains 4, pleckstrin homology, Sec7 and coiled-coil domains 4, PSCD4DJ63G5.1
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 27128
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9UIA0
Gene Symbols: CYTH4
Immunogen: Synthetic peptides corresponding to PSCD4(pleckstrin homology, Sec7 and coiled-coil domains 4) The peptide sequence was selected from the N terminal of PSCD4. Peptide sequence NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Pig: 100%; Bovine: 100%; Rat: 92%; Mouse: 92%; Western clawed frog: 90%; Xenopus: 90%; Zebrafish: 90%; Rainbow smelt: 90%; Atlantic salmon: 78%; Green puffer: 78%; Chicken: 78%; Green monkey: 78%; Human: 100%;.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: ZC3H14
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: FLJ11806, Mammalian suppressor of tau pathology-2, MGC26892, MSUT-2, nuclear protein UKp68, NY-REN-37, Renal carcinoma antigen NY-REN-37, SUT2, UKp68, zinc finger CCCH domain-containing protein 14, zinc finger CCCH-type containing 14
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 79882
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Accession No.: Q6PJT7
Gene Symbols: ZC3H14
Immunogen: Synthetic peptides corresponding to ZC3H14(zinc finger CCCH-type containing 14) The peptide sequence was selected from the N terminal of ZC3H14. Peptide sequence KFPSPPLPIFLPPEPVDLGSITSSSCSLNELDNISHLLRKISADINEIKG.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Rat: 85%.
Target Species: Human, Mouse, Rat
Isotype: IgG
Antigen: ZC3H14
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: FLJ11806, Mammalian suppressor of tau pathology-2, MGC26892, MSUT-2, nuclear protein UKp68, NY-REN-37, Renal carcinoma antigen NY-REN-37, SUT2, UKp68, zinc finger CCCH domain-containing protein 14, zinc finger CCCH-type containing 14
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 79882
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry
Concentration: __
Dilution: Western Blot 1:100-1:2000, Immunohistochemistry
Gene Accession No.: Q6PJT7
Gene Symbols: ZC3H14
Immunogen: Synthetic peptides corresponding to ZC3H14(zinc finger CCCH-type containing 14) The peptide sequence was selected from the N terminal of ZC3H14. Peptide sequence KFPSPPLPIFLPPEPVDLGSITSSSCSLNELDNISHLLRKISADINEIKG.
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
