Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP156977-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP156977 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
Cytosolic Sulfotransferase 1E1/SULT1E1
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
EC 2.8.2, EST-1, ESTMGC34459, estrone sulfotransferase, ST1E1, STEestrogen sulfotransferase, Sulfotransferase 1E1, sulfotransferase family 1E, estrogen-preferring, member 1, Sulfotransferase, estrogen-preferringEC 2.8.2.4
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Human: 100%; Rabbit: 91%; Equine: 85%; Canine: 84%.
Target Species
Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Gene Accession No.
P49888
Gene Symbols
SULT1E1
Immunogen
Synthetic peptides corresponding to SULT1E1 (sulfotransferase family 1E, estrogen-preferring, member 1) The peptide sequence was selected from the middle region of SULT1E1. Peptide sequence LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY The peptide sequence for this immunogen was taken from within the described region.
Quantity
100 μL
Research Discipline
Breast Cancer, Stem Cell Markers
Gene ID (Entrez)
6783
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Cytosolic Sulfotransferase 1E1/SULT1E1 Polyclonal specifically detects Cytosolic Sulfotransferase 1E1/SULT1E1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Cytosolic Sulfotransferase 1E1/SULT1E1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: EC 2.8.2, EST-1, ESTMGC34459, estrone sulfotransferase, ST1E1, STEestrogen sulfotransferase, Sulfotransferase 1E1, sulfotransferase family 1E, estrogen-preferring, member 1, Sulfotransferase, estrogen-preferringEC 2.8.2.4
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 91%; Equine: 85%; Canine: 84%.
Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Gene Accession No.: P49888
Gene Symbols: SULT1E1
Immunogen: Synthetic peptides corresponding to SULT1E1 (sulfotransferase family 1E, estrogen-preferring, member 1) The peptide sequence was selected from the middle region of SULT1E1. Peptide sequence LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY The peptide sequence for this immunogen was taken from within the described region.
Quantity: 100 μL
Research Discipline: Breast Cancer, Stem Cell Markers
Gene ID (Entrez): 6783
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: Cytosolic Sulfotransferase 1E1/SULT1E1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: EC 2.8.2, EST-1, ESTMGC34459, estrone sulfotransferase, ST1E1, STEestrogen sulfotransferase, Sulfotransferase 1E1, sulfotransferase family 1E, estrogen-preferring, member 1, Sulfotransferase, estrogen-preferringEC 2.8.2.4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: __
Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Gene Accession No.: P49888
Gene Symbols: SULT1E1
Immunogen: Synthetic peptides corresponding to SULT1E1 (sulfotransferase family 1E, estrogen-preferring, member 1) The peptide sequence was selected from the middle region of SULT1E1. Peptide sequence LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLF
Quantity: 20 μL
Research Discipline: Breast Cancer, Stem Cell Markers
Gene ID (Entrez): 6783
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Antigen: DXO
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: DOM-3 (C. elegans) homolog Z, Dom-3 homolog Z, dom-3 homolog Z (C. elegans), DOM3L, DOM3Z, NG6, protein Dom3Z, RAI1
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Canine: 92%; Pig: 92%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: O77932
Gene Symbols: DXO
Immunogen: Synthetic peptides corresponding to DXO (dom-3 homolog Z (C. elegans)) The peptide sequence was selected from the N terminal of DXO. Peptide sequence LYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDL.
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 1797
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.