EIF4A3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP157342-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP157342 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
EIF4A3
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, eIF4AIII, eIF-4A-III, eIF4A-III, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34
Host Species
Rabbit
Purification Method
Protein A purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Human: 100%; Yellowfever mosquito: 100%; Glume blotch fungus: 100%;Caenorhabditis elegans: 100%; Xenopus: 100%; Silk moth: 100%; Blackleg fungus: 100%; Mosquito: 100%; Channel catfish: 100%; Bovine: 100%;Aspergillus oryzae: 100%; Zebrafish: 100%; African malaria mosquito: 100%; Chicken: 100%;Aspergillus nidulans: 100%;Sartorya fumigata: 100%; Green puffer: 100%; Crab-eating macaque: 100%; Rat: 100%; blue catfish: 100%;Pyrenophora teres f. teres0-1: 100%; Western clawed frog: 100%; Zebra finch: 100%; Atlantic salmon: 100%;Caenorhabditis briggsae: 100%; Filarial nematode worm: 100%; Pig: 100%; Mouse: 100%;Aspergillus clavatus: 100%; Northern pike: 100%;Caligus clemensi: 100%; Florida lancelet: 100%;Caenorhabditis vulgaris: 100%; Canine: 100%;Harpegnathos saltator: 100%;Camponotus floridanus: 100%; Eye worm: 100%; Red flour beetle: 100%; Perigord truffle:
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Yeast, Zebrafish
Form
Purified
Applications
Western Blot
Concentration
1 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
P38919
Gene Symbols
EIF4A3
Immunogen
Synthetic peptides corresponding to DDX48 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 48) The peptide sequence was selected from the middle region of DDX48. Peptide sequence QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV.
Quantity
100 μL
Research Discipline
Signal Transduction
Gene ID (Entrez)
9775
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Related Products
Description
- EIF4A3 Polyclonal specifically detects EIF4A3 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: EIF4A3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, eIF4AIII, eIF-4A-III, eIF4A-III, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Yellowfever mosquito: 100%; Glume blotch fungus: 100%;Caenorhabditis elegans: 100%; Xenopus: 100%; Silk moth: 100%; Blackleg fungus: 100%; Mosquito: 100%; Channel catfish: 100%; Bovine: 100%;Aspergillus oryzae: 100%; Zebrafish: 100%; African malaria mosquito: 100%; Chicken: 100%;Aspergillus nidulans: 100%;Sartorya fumigata: 100%; Green puffer: 100%; Crab-eating macaque: 100%; Rat: 100%; blue catfish: 100%;Pyrenophora teres f. teres0-1: 100%; Western clawed frog: 100%; Zebra finch: 100%; Atlantic salmon: 100%;Caenorhabditis briggsae: 100%; Filarial nematode worm: 100%; Pig: 100%; Mouse: 100%;Aspergillus clavatus: 100%; Northern pike: 100%;Caligus clemensi: 100%; Florida lancelet: 100%;Caenorhabditis vulgaris: 100%; Canine: 100%;Harpegnathos saltator: 100%;Camponotus floridanus: 100%; Eye worm: 100%; Red flour beetle: 100%; Perigord truffle:
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Yeast, Zebrafish
Form: Purified
Applications: Western Blot
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: P38919
Gene Symbols: EIF4A3
Immunogen: Synthetic peptides corresponding to DDX48 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 48) The peptide sequence was selected from the middle region of DDX48. Peptide sequence QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV.
Quantity: 100 μL
Research Discipline: Signal Transduction
Gene ID (Entrez): 9775
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: EIF4A3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, eIF-4A-III, eIF4A-III, EIF4AIII, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Form: Purified
Applications: Western Blot
Concentration: __
Dilution: Western Blot 1:100-1:2000
Gene Accession No.: P38919
Gene Symbols: EIF4A3
Immunogen: Synthetic peptides corresponding to DDX48 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 48) The peptide sequence was selected from the middle region of DDX48. Peptide sequence QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV.
Quantity: 20 μL
Research Discipline: __
Gene ID (Entrez): 9775
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: DHX35
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: C20orf15, DDX35, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 35, DEAH (Asp-Glu-Ala-His) box polypeptide 35, DEAH box protein 35, DEAH-box protein 35, EC 3.6.1, EC 3.6.4.13, FLJ22759, KAIA0875, probable ATP-dependent RNA helicase DHX35
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Form: __
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9H5Z1
Gene Symbols: DHX35
Immunogen: Synthetic peptides corresponding to DHX35(DEAH (Asp-Glu-Ala-His) box polypeptide 35) The peptide sequence was selected from the N terminal of DHX35. Peptide sequence MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ.
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 60625
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG