Manufacturer: Novus Biologicals
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP157711-Each-of-1 | In Stock | ₹ 44,633.50 |
NBP157711 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 44,633.50
GST (18%): ₹ 8,034.03
Total Price: ₹ 52,667.53
OVCA1
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
Diphthamide biosynthesis protein 2 homolog-like 1, Diphthamide biosynthesis protein 2-like, diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae), DPH1 homolog, DPH1 homolog (S. cerevisiae), DPH2L, DPH2L1diphthamide biosynthesis protein 1, DPH2-like 1, DPH-like 1, DPH-like 1 (S. cerevisiae), FLJ33211, hsDph1, Ovarian cancer-associated gene 1 protein, ovarian tumor suppressor candidate 1, OVCA1candidate tumor suppressor in ovarian cancer 1
Rabbit
Affinity purified
RUO
1801
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
0.5 mg/ml
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Q9BZG8
DPH1
Synthetic peptides corresponding to DPH1 (DPH1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of DPH1)(50ug). Peptide sequence NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG.
100 μL
Primary
Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Bovine: 92%; Yeast: 84%; Zebrafish: 84%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
IgG