Serpin C1/Antithrombin-III Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP157918-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP157918 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
Serpin C1/Antithrombin-III
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
AT3antithrombin-III, ATIIIantithrombin III, MGC22579, serine (or cysteine) proteinase inhibitor, clade C (antithrombin), member 1, serine-cysteine proteinase inhibitor clade C member 1, Serpin C1, serpin peptidase inhibitor, clade C (antithrombin), member 1
Host Species
Rabbit
Molecular Weight of Antigen
52 kDa
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Canine: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Bovine: 92%; Guinea pig: 92%; Equine: 92%; Human: 92%; Zebrafish: 92%; Chicken: 85%.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.
P01008
Gene Symbols
SERPINC1
Immunogen
Synthetic peptides corresponding to SERPINC1(serpin peptidase inhibitor, clade C (antithrombin), member 1) The peptide sequence was selected from the middle region of SERPINC1. Peptide sequence ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD The peptide sequence for this immunogen was taken from within the described region.
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
462
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Serpin C1/Antithrombin-III Polyclonal specifically detects Serpin C1/Antithrombin-III in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Serpin C1/Antithrombin-III
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: AT3antithrombin-III, ATIIIantithrombin III, MGC22579, serine (or cysteine) proteinase inhibitor, clade C (antithrombin), member 1, serine-cysteine proteinase inhibitor clade C member 1, Serpin C1, serpin peptidase inhibitor, clade C (antithrombin), member 1
Host Species: Rabbit
Molecular Weight of Antigen: 52 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Bovine: 92%; Guinea pig: 92%; Equine: 92%; Human: 92%; Zebrafish: 92%; Chicken: 85%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: P01008
Gene Symbols: SERPINC1
Immunogen: Synthetic peptides corresponding to SERPINC1(serpin peptidase inhibitor, clade C (antithrombin), member 1) The peptide sequence was selected from the middle region of SERPINC1. Peptide sequence ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD The peptide sequence for this immunogen was taken from within the described region.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 462
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: Serpin C1/Antithrombin-III
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS & 2% Sucrose. with No Preservative
Gene Alias: AT3antithrombin-III, ATIIIantithrombin III, MGC22579, serine (or cysteine) proteinase inhibitor, clade C (antithrombin), member 1, serine-cysteine proteinase inhibitor clade C member 1, Serpin C1, serpin peptidase inhibitor, clade C (antithrombin), member 1
Host Species: Rabbit
Molecular Weight of Antigen: 52 kDa
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: __
Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: P01008
Gene Symbols: SERPINC1
Immunogen: Synthetic peptides corresponding to SERPINC1(serpin peptidase inhibitor, clade C (antithrombin), member 1) The peptide sequence was selected from the middle region of SERPINC1. Peptide sequence ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFN
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 462
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Antigen: Carboxypeptidase B2/CPB2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: carboxypeptidase B2, carboxypeptidase B2 (plasma), carboxypeptidase B2 (plasma, carboxypeptidase U), Carboxypeptidase U, CPUEC 3.4.17.20, EC 3.4.17, PCPB, Plasma carboxypeptidase B, TAFIcarboxypeptidase B-like protein, Thrombin-activable fibrinolysis inhibitor, thrombin-activatable fibrinolysis inhibitor
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 85%; Pig: 78%.
Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q96IY4
Gene Symbols: CPB2
Immunogen: Synthetic peptides corresponding to CPB2(carboxypeptidase B2 (plasma)) The peptide sequence was selected from the middle region of CPB2. Peptide sequence RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 1361
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.