Carboxyl Ester Lipase/CEL Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP157922-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP157922 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
Carboxyl Ester Lipase/CEL
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols
CEL
Immunogen
The immunogen is a synthetic peptide directed towards the C - terminal region of human Carboxyl Ester Lipase/CEL. Peptide Sequence VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR. The peptide sequence for this immunogen was taken from within the described region.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Human: 100%; Rat: 100%; Mouse: 76%.
Target Species
Human, Mouse, Rat, Porcine, Equine
Isotype
IgG
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Alias
BAL, bile salt-activated lipase, Bile salt-stimulated lipase, BSDL, BSSLbile salt-dependent lipase, oncofetal isoform, bucelipase, carboxyl ester hydrolase, Carboxyl ester lipase, carboxyl ester lipase (bile salt-stimulated lipase), CEase, CELL, Cholesterol esterase, EC 3.1.1, EC 3.1.1.13, EC 3.1.1.3, FAP, FAPP, fetoacinar pancreatic protein, LIPA, lysophospholipase, pancreatic, MODY8bile-salt-activated lipase, Pancreatic lysophospholipase, Sterol esterase
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
1056
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Carboxyl Ester Lipase/CEL Polyclonal specifically detects Carboxyl Ester Lipase/CEL in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: Carboxyl Ester Lipase/CEL
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: CEL
Immunogen: The immunogen is a synthetic peptide directed towards the C - terminal region of human Carboxyl Ester Lipase/CEL. Peptide Sequence VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR. The peptide sequence for this immunogen was taken from within the described region.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rat: 100%; Mouse: 76%.
Target Species: Human, Mouse, Rat, Porcine, Equine
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: BAL, bile salt-activated lipase, Bile salt-stimulated lipase, BSDL, BSSLbile salt-dependent lipase, oncofetal isoform, bucelipase, carboxyl ester hydrolase, Carboxyl ester lipase, carboxyl ester lipase (bile salt-stimulated lipase), CEase, CELL, Cholesterol esterase, EC 3.1.1, EC 3.1.1.13, EC 3.1.1.3, FAP, FAPP, fetoacinar pancreatic protein, LIPA, lysophospholipase, pancreatic, MODY8bile-salt-activated lipase, Pancreatic lysophospholipase, Sterol esterase
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 1056
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: PNPLA4
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: PNPLA4
Immunogen: Synthetic peptides corresponding to PNPLA4(patatin-like phospholipase domain containing 4) The peptide sequence was selected from the C terminal of PNPLA4. Peptide sequence SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKM.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Pig: 100%; Chicken: 92%; Xenopus: 83%.
Target Species: Human, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: calcium independent phospholipases A2 eta, DXS1283Epatatin-like phospholipase domain-containing protein 4, GS2EC 3.1.1.3, IPLA2 eta, patatin-like phospholipase domain containing 4, Protein GS2
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 8228
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: PNPLA4
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: PNPLA4
Immunogen: Synthetic peptides corresponding to PNPLA4(patatin-like phospholipase domain containing 4) The peptide sequence was selected from the C terminal of PNPLA4. Peptide sequence SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKM.
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
Applications: Western Blot
Concentration: __
Dilution: Western Blot 1:100-1:2000
Gene Alias: calcium independent phospholipases A2 eta, DXS1283Epatatin-like phospholipase domain-containing protein 4, GS2EC 3.1.1.3, IPLA2 eta, patatin-like phospholipase domain containing 4, Protein GS2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 8228
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
