Ext2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP158297-Each-of-1 | In Stock | ₹ 42,737.22 |
NBP158297 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,737.22
GST (18%): ₹ 7,692.70
Total Price: ₹ 50,429.92
Antigen
Ext2
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
EC 2.4.1.224, EC 2.4.1.225, exostoses (multiple) 2, exostosin 2, exostosin-2, Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan4-alpha-N-acetylglucosaminyltransferase, Multiple exostoses protein 2, N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase, Putative tumor suppressor protein EXT2, SOTV
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
2132
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Accession No.
Q93063
Gene Symbols
EXT2
Immunogen
Synthetic peptides corresponding to EXT2(exostoses (multiple) 2) The peptide sequence was selected from the N terminal of exostosin 2. Peptide sequence NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%; Rat: 92%; Bovine: 85%; Chicken: 85%; Guinea pig: 85%; Zebrafish: 78%.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype
IgG
Related Products
Description
- Ext2 Polyclonal specifically detects Ext2 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Ext2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: EC 2.4.1.224, EC 2.4.1.225, exostoses (multiple) 2, exostosin 2, exostosin-2, Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan4-alpha-N-acetylglucosaminyltransferase, Multiple exostoses protein 2, N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase, Putative tumor suppressor protein EXT2, SOTV
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 2132
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Accession No.: Q93063
Gene Symbols: EXT2
Immunogen: Synthetic peptides corresponding to EXT2(exostoses (multiple) 2) The peptide sequence was selected from the N terminal of exostosin 2. Peptide sequence NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%; Rat: 92%; Bovine: 85%; Chicken: 85%; Guinea pig: 85%; Zebrafish: 78%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: Ext2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: EC 2.4.1.224, EC 2.4.1.225, exostoses (multiple) 2, exostosin 2, exostosin-2, Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan4-alpha-N-acetylglucosaminyltransferase, Multiple exostoses protein 2, N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase, Putative tumor suppressor protein EXT2, SOTV
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 2132
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry
Concentration: __
Dilution: Western Blot 0.2-1 ug/ml, Immunohistochemistry
Gene Accession No.: Q93063
Gene Symbols: EXT2
Immunogen: Synthetic peptides corresponding to EXT2(exostoses (multiple) 2) The peptide sequence was selected from the N terminal of exostosin 2. Peptide sequence NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW.
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
Antigen: DUSP8
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: C11orf81, chromosome 11 open reading frame 81, dual specificity phosphatase 8, Dual specificity protein phosphatase hVH-5, EC 3.1.3.16, EC 3.1.3.48, FLJ42476, FLJ42958, HVH8, serine/threonine specific protein phosphatase, vaccinia virus homolog, VH5
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 1850
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q13202
Gene Symbols: DUSP8
Immunogen: Synthetic peptides corresponding to DUSP8(dual specificity phosphatase 8) The peptide sequence was selected from the middle region of DUSP8. Peptide sequence PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Mouse: 100%; Guinea pig: 92%; Chicken: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig
Isotype: IgG