Manufacturer: Novus Biologicals
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP158349-Each-of-1 | In Stock | ₹ 43,387.50 |
NBP158349 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 43,387.50
GST (18%): ₹ 7,809.75
Total Price: ₹ 51,197.25
G protein alpha
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
Adenylate cyclase-stimulating G alpha protein, AHO, Alternative gene product encoded by XL-exon, Extra large alphas protein, GNAS complex locus, GNAS1GSA, GNASXL, GPSAC20orf45, GSP, guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide 1, guanine nucleotide regulatory protein, guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas, MGC33735, NESP, NESP55, neuroendocrine secretory protein, PHP1A, PHP1B, PHP1C, POH, protein ALEX, SCG6, secretogranin VI, XLalphas
Rabbit
Affinity purified
RUO
Primary
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
0.5 mg/ml
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
P63092
GNAS
Synthetic peptides corresponding to GNAS(GNAS complex locus) The peptide sequence was selected from the N terminal of GNAS. Peptide sequence VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD.
100 μL
Signal Transduction
2778
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.