Manufacturer: Fischer Scientific
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP159034-Each-of-1 | In Stock | ₹ 43,387.50 |
NBP159034 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 43,387.50
GST (18%): ₹ 7,809.75
Total Price: ₹ 51,197.25
Atlastin-3
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
atlastin 3, atlastin GTPase 3, atlastin-3, DKFZP564J0863, EC 3.6.5.-
Rabbit
Affinity purified
RUO
25923
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q6DD88
ATL3
Synthetic peptides corresponding to DKFZP564J0863 The peptide sequence was selected from the middle region of DKFZP564J0863. Peptide sequence DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA.
100 μL
Primary
Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Mouse: 100%; Crab-eating macaque: 100%; Bovine: 92%; Streptococcus pneumoniae BS458: 83%; Streptococcus pneumoniae BS457: 83%; Streptococcus pneumoniae BS397: 83%; Streptococcus pneumoniae SP14-BS292: 83%; Streptococcus pneumoniae SP-BS293: 83%; Streptococcus pneumoniae BS455: 83%; Streptococcus mitis SK564: 83%; Streptococcus mitis SK597: 83%; Streptococcus mitis NCTC 12261: 83%; Streptococcus pneumoniae: 83%; Streptococcus pneumoniae MLV-016: 83%; Streptococcus pneumoniae CDC3059-06: 83%; Streptococcus pneumoniae SP3-BS71: 83%; Streptococcus pneumoniae SP6-BS73: 83%; Streptococcus pneumoniae SP9-BS68: 83%; Streptococcus pneumoniae SP11-BS70: 83%; Streptococcus pneumoniae SP14-BS69: 83%; Streptococcus pneumoniae SP18-BS74: 83%; Streptococcus pneumoniae SP19-BS75: 83%; Streptococcus pneumoniae SP23-BS72: 83%; Streptococcus pneumoniae CDC1873-00: 83%; Streptococcus pneumoniae SP195: 83%; Streptococcus pneumoniae CDC0
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG