ASPP1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP159093-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP159093 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
ASPP1
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
apoptosis-stimulating protein of p53, 1, ASPP1Protein phosphatase 1 regulatory subunit 13B, KIAA0771apoptosis-stimulating of p53 protein 1, p53BP2-like, p85, protein phosphatase 1, regulatory (inhibitor) subunit 13B
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
23368
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
Q96KQ4
Gene Symbols
PPP1R13B
Immunogen
Synthetic peptides corresponding to PPP1R13B(protein phosphatase 1, regulatory (inhibitor) subunit 13B) The peptide sequence was selected from the middle region of PPP1R13B. Peptide sequence EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA The peptide sequence for this immunogen was taken from within the described region.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 92%; Rabbit: 92%; Zebrafish: 85%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype
IgG
Related Products
Description
- ASPP1 Polyclonal specifically detects ASPP1 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: ASPP1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: apoptosis-stimulating protein of p53, 1, ASPP1Protein phosphatase 1 regulatory subunit 13B, KIAA0771apoptosis-stimulating of p53 protein 1, p53BP2-like, p85, protein phosphatase 1, regulatory (inhibitor) subunit 13B
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 23368
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q96KQ4
Gene Symbols: PPP1R13B
Immunogen: Synthetic peptides corresponding to PPP1R13B(protein phosphatase 1, regulatory (inhibitor) subunit 13B) The peptide sequence was selected from the middle region of PPP1R13B. Peptide sequence EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA The peptide sequence for this immunogen was taken from within the described region.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 92%; Rabbit: 92%; Zebrafish: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: ELMOD2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: ELMO domain containing 2, ELMO domain-containing protein 2,9830169G11Rik, ELMO/CED-12 domain containing 2, FLJ35768, FLJ38038, MGC10084
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 255520
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q8IZ81
Gene Symbols: ELMOD2
Immunogen: Synthetic peptides corresponding to ELMOD2(ELMO/CED-12 domain containing 2) The peptide sequence was selected from the N terminal of ELMOD2. Peptide sequence FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Canine: 92%; Rat: 92%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Antigen: ELMOD2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: ELMO domain containing 2, ELMO domain-containing protein 2,9830169G11Rik, ELMO/CED-12 domain containing 2, FLJ35768, FLJ38038, MGC10084
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 255520
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: __
Dilution: Western Blot 1:100-1:2000
Gene Accession No.: Q8IZ81
Gene Symbols: ELMOD2
Immunogen: Synthetic peptides corresponding to ELMOD2(ELMO/CED-12 domain containing 2) The peptide sequence was selected from the N terminal of ELMOD2. Peptide sequence FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN.
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
