Neuregulin-3/NRG3 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP159338-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP159338 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
Neuregulin-3/NRG3
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
HRG3, neuregulin 3, neuregulin 3 variant 1, neuregulin 3 variant 10, neuregulin 3 variant 11, neuregulin 3 variant 12, neuregulin 3 variant 13, neuregulin 3 variant 14, neuregulin 3 variant 3, neuregulin 3 variant 4, neuregulin 3 variant 5, neuregulin 3 variant 6, neuregulin 3 variant 7, neuregulin 3 variant 8, neuregulin 3 variant 9, neuregulin-3-like polypeptide, pro-neuregulin-3, membrane-bound isoform, pro-NRG3
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
10718
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Gene Accession No.
P56975-4
Gene Symbols
NRG3
Immunogen
Synthetic peptides corresponding to NRG3(neuregulin 3) The peptide sequence was selected from the middle region of NRG3. Peptide sequence TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%; Equine: 92%; Pig: 92%; Chicken: 91%; Canine: 85%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype
IgG
Related Products
Description
- Neuregulin-3/NRG3 Polyclonal specifically detects Neuregulin-3/NRG3 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Neuregulin-3/NRG3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: HRG3, neuregulin 3, neuregulin 3 variant 1, neuregulin 3 variant 10, neuregulin 3 variant 11, neuregulin 3 variant 12, neuregulin 3 variant 13, neuregulin 3 variant 14, neuregulin 3 variant 3, neuregulin 3 variant 4, neuregulin 3 variant 5, neuregulin 3 variant 6, neuregulin 3 variant 7, neuregulin 3 variant 8, neuregulin 3 variant 9, neuregulin-3-like polypeptide, pro-neuregulin-3, membrane-bound isoform, pro-NRG3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 10718
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Gene Accession No.: P56975-4
Gene Symbols: NRG3
Immunogen: Synthetic peptides corresponding to NRG3(neuregulin 3) The peptide sequence was selected from the middle region of NRG3. Peptide sequence TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%; Equine: 92%; Pig: 92%; Chicken: 91%; Canine: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Antigen: Peptide YY
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Peptide tyrosine tyrosine, peptide YY, PYY1, PYY-I
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 5697
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: P10082
Gene Symbols: PYY
Immunogen: Synthetic peptides corresponding to PYY(peptide YY) The peptide sequence was selected from the middle region of PYY. Peptide sequence APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: Neprilysin-2/MMEL1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: EC 3.4.24, EC 3.4.24.11, MELL1, membrane metallo-endopeptidase-like 1, Membrane metallo-endopeptidase-like 2MGC119455, MGC119454, MMEL2, NEP2, NEP2(m), NEPIIMGC119456, Neprilysin II, Neprilysin-2, NL2NL1, SEP, soluble secreted endopeptidase, zinc metallopeptidase
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 79258
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: __
Gene Symbols: MMEL1
Immunogen: Synthetic peptides corresponding to MMEL1(membrane metallo-endopeptidase-like 1) The peptide sequence was selected from the middle region of MMEL1. Peptide sequence EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Equine: 92%; Pig: 78%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
Isotype: IgG