ELOVL5 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP159539-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP159539 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
ELOVL5
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
dJ483K16.1, EC 2.3.1.n8, elongation of very long chain fatty acids protein 5, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, ELOVL2,3-keto acyl-CoA synthase ELOVL5, Fatty acid elongase 1, hELO1, HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, homolog of yeast long chain polyunsaturated fatty acid elongatio, SUR4/Elo3-like, yeast)
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Horse: 79%.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
Isotype
IgG
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
Q9NYP7
Gene Symbols
ELOVL5
Immunogen
Synthetic peptides corresponding to ELOVL5(ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)) The peptide sequence was selected from the N terminal of ELOVL5. Peptide sequence EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK The peptide sequence for this immunogen was taken from within the described region.
Quantity
100 μL
Research Discipline
Cardiovascular Biology, Cellular Signaling
Gene ID (Entrez)
60481
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ELOVL5 Polyclonal specifically detects ELOVL5 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: ELOVL5
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: dJ483K16.1, EC 2.3.1.n8, elongation of very long chain fatty acids protein 5, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, ELOVL2,3-keto acyl-CoA synthase ELOVL5, Fatty acid elongase 1, hELO1, HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, homolog of yeast long chain polyunsaturated fatty acid elongatio, SUR4/Elo3-like, yeast)
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Horse: 79%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9NYP7
Gene Symbols: ELOVL5
Immunogen: Synthetic peptides corresponding to ELOVL5(ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)) The peptide sequence was selected from the N terminal of ELOVL5. Peptide sequence EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK The peptide sequence for this immunogen was taken from within the described region.
Quantity: 100 μL
Research Discipline: Cardiovascular Biology, Cellular Signaling
Gene ID (Entrez): 60481
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: ARV1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: ARV1 homolog (S. cerevisiae), ARV1 homolog (yeast), hARV1, protein ARV1
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 84%; Goat: 84%; Pig: 84%; Canine: 78%.
Target Species: Human, Porcine, Bovine, Canine, Goat, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9H2C2
Gene Symbols: ARV1
Immunogen: Synthetic peptides corresponding to ARV1(ARV1 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of ARV1 (NP_073623). Peptide sequence: QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD.
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 64801
Reconstitution: Centrifuge vial prior to reconstitution. Reconstitute in 50μL distilled water to a final antibody concentration of 1mg/mL.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: MARCO
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: macrophage receptor with collagenous structureSCARA2Scavenger receptor class A member 2, member 2
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
Target Species: Human
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9UEW3
Gene Symbols: MARCO
Immunogen: Synthetic peptides corresponding to MARCO(macrophage receptor with collagenous structure) The peptide sequence was selected from the N terminal of MARCO. Peptide sequence QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL.
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 8685
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.