SLC39A8/ZIP8 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP159601-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP159601 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
SLC39A8/ZIP8
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
BCG induced integral membrane protein BIGM103, BIGM103BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6, LZT-Hs6, solute carrier family 39 (metal ion transporter), member 8, solute carrier family 39 (zinc transporter), member 8, Solute carrier family 39 member 8, zinc transporter ZIP8, ZIP8, ZIP-8, Zrt- and Irt-like protein 8
Host Species
Rabbit
Molecular Weight of Antigen
50 kDa
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Porcine 85%, Canine 79%.
Target Species
Human, Rat, Porcine, Canine, Equine
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.
Q9C0K1
Gene Symbols
SLC39A8
Immunogen
Synthetic peptides corresponding to SLC39A8(solute carrier family 39 (zinc transporter), member 8) The peptide sequence was selected from the N terminal of SLC39A8. Peptide sequence QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS.
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
64116
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SLC39A8/ZIP8 Polyclonal antibody specifically detects SLC39A8/ZIP8 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Compare Similar Items
Show Difference
Antigen: SLC39A8/ZIP8
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: BCG induced integral membrane protein BIGM103, BIGM103BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6, LZT-Hs6, solute carrier family 39 (metal ion transporter), member 8, solute carrier family 39 (zinc transporter), member 8, Solute carrier family 39 member 8, zinc transporter ZIP8, ZIP8, ZIP-8, Zrt- and Irt-like protein 8
Host Species: Rabbit
Molecular Weight of Antigen: 50 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Porcine 85%, Canine 79%.
Target Species: Human, Rat, Porcine, Canine, Equine
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: Q9C0K1
Gene Symbols: SLC39A8
Immunogen: Synthetic peptides corresponding to SLC39A8(solute carrier family 39 (zinc transporter), member 8) The peptide sequence was selected from the N terminal of SLC39A8. Peptide sequence QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 64116
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: SLC25A46
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: solute carrier family 25 member 46, solute carrier family 25, member 46, TB1
Host Species: Rabbit
Molecular Weight of Antigen: 46 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat, Porcine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q96AG3
Gene Symbols: SLC25A46
Immunogen: Synthetic peptides corresponding to SLC25A46(solute carrier family 25, member 46) The peptide sequence was selected from the C terminal of SLC25A46. Peptide sequence LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 91137
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: SLC25A42
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: MGC26694, solute carrier family 25 member 42, solute carrier family 25, member 42
Host Species: Rabbit
Molecular Weight of Antigen: 35 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q86VD7
Gene Symbols: SLC25A42
Immunogen: Synthetic peptides corresponding to SLC25A42(solute carrier family 25, member 42) The peptide sequence was selected from the N terminal of SLC25A42. Peptide sequence GNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAV.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 284439
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.