GALNTL4 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP159681-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP159681 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
GALNTL4
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
EC 2.4.1.41, GalNAc-T15, GalNAc-T-like protein 4, GalNAc-transferase 18, GALNT15, GALNT18, MGC71806, Polypeptide GalNAc transferase-like protein 4, pp-GaNTase-like protein 4, Protein-UDP acetylgalactosaminyltransferase-like protein 4, putative polypeptide N-acetylgalactosaminyltransferase-like protein 4, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 4, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 15, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase-like 4
Host Species
Rabbit
Molecular Weight of Antigen
69 kDa
Quantity
100 μL
Primary or Secondary
Primary
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
Q6P9A2
Gene Symbols
GALNT18
Immunogen
Synthetic peptides corresponding to GALNTL4(UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 4) The peptide sequence was selected from the middle region of GALNTL4. Peptide sequence IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHV The peptide sequence for this immunogen was taken from within the described region.
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
374378
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype
IgG
Related Products
Description
- GALNTL4 Polyclonal specifically detects GALNTL4 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: GALNTL4
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: EC 2.4.1.41, GalNAc-T15, GalNAc-T-like protein 4, GalNAc-transferase 18, GALNT15, GALNT18, MGC71806, Polypeptide GalNAc transferase-like protein 4, pp-GaNTase-like protein 4, Protein-UDP acetylgalactosaminyltransferase-like protein 4, putative polypeptide N-acetylgalactosaminyltransferase-like protein 4, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 4, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 15, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase-like 4
Host Species: Rabbit
Molecular Weight of Antigen: 69 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q6P9A2
Gene Symbols: GALNT18
Immunogen: Synthetic peptides corresponding to GALNTL4(UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 4) The peptide sequence was selected from the middle region of GALNTL4. Peptide sequence IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHV The peptide sequence for this immunogen was taken from within the described region.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 374378
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: SLC41A2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: DKFZP434K0427, MGC125330, MGC125331, SLC41A1-L1, SLC41A1-like 1, solute carrier family 41 member 2, solute carrier family 41, member 2
Host Species: Rabbit
Molecular Weight of Antigen: 53 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: __
Gene Symbols: SLC41A2
Immunogen: Synthetic peptides corresponding to SLC41A2(solute carrier family 41, member 2) The peptide sequence was selected from the N terminal of SLC41A2. Peptide sequence SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK.
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 84102
Target Species: Human, Mouse, Bovine, Canine, Equine, Rabbit
Isotype: IgG
Antigen: TMEM75
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: FLJ36105, transmembrane protein 75
Host Species: Rabbit
Molecular Weight of Antigen: 15 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q8N9X5
Gene Symbols: TMEM75
Immunogen: Synthetic peptides corresponding to TMEM75(transmembrane protein 75) The peptide sequence was selected from the C terminal of TMEM75. Peptide sequence VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 641384
Target Species: Human
Isotype: IgG
