SLC10A5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP159707-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP159707 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
SLC10A5
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
Na(+)/bile acid cotransporter 5, P5, sodium/bile acid cotransporter 5, solute carrier family 10 (sodium/bile acid cotransporter family), member 5, Solute carrier family 10 member 5
Host Species
Rabbit
Molecular Weight of Antigen
48 kDa
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Porcine 79%.
Target Species
Human, Rat, Porcine, Equine
Form
Purified
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
1 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.
Q5PT55
Gene Symbols
SLC10A5
Immunogen
Synthetic peptides corresponding to SLC10A5(solute carrier family 10 (sodium/bile acid cotransporter family), member 5) The peptide sequence was selected from the C terminal of SLC10A5. Peptide sequence GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP The peptide sequence for this immunogen was taken from within the described region.
Purification Method
Protein A purified
Regulatory Status
RUO
Gene ID (Entrez)
347051
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Description
- SLC10A5 Polyclonal specifically detects SLC10A5 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SLC10A5
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Na(+)/bile acid cotransporter 5, P5, sodium/bile acid cotransporter 5, solute carrier family 10 (sodium/bile acid cotransporter family), member 5, Solute carrier family 10 member 5
Host Species: Rabbit
Molecular Weight of Antigen: 48 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Porcine 79%.
Target Species: Human, Rat, Porcine, Equine
Form: Purified
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: Q5PT55
Gene Symbols: SLC10A5
Immunogen: Synthetic peptides corresponding to SLC10A5(solute carrier family 10 (sodium/bile acid cotransporter family), member 5) The peptide sequence was selected from the C terminal of SLC10A5. Peptide sequence GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP The peptide sequence for this immunogen was taken from within the described region.
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 347051
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: SLC10A5
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Na(+)/bile acid cotransporter 5, P5, sodium/bile acid cotransporter 5, solute carrier family 10 (sodium/bile acid cotransporter family), member 5, Solute carrier family 10 member 5
Host Species: Rabbit
Molecular Weight of Antigen: 48 kDa
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Form: Purified
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: __
Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: Q5PT55
Gene Symbols: SLC10A5
Immunogen: Synthetic peptides corresponding to SLC10A5(solute carrier family 10 (sodium/bile acid cotransporter family), member 5) The peptide sequence was selected from the C terminal of SLC10A5. Peptide sequence GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQL
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 347051
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: Activin RIIB
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: activin A receptor, type IIB, Activin receptor type IIB, activin receptor type-2B, ACTRIIB, ACTR-IIB, EC 2.7.11, EC 2.7.11.30, MGC116908
Host Species: Rabbit
Molecular Weight of Antigen: 33 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Form: __
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q4VAU9
Gene Symbols: ACVR2B
Immunogen: Synthetic peptides corresponding to ACVR2B(activin A receptor, type IIB) The peptide sequence was selected from the C terminal of Activin Receptor Type 2B. Peptide sequence HDAEARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 93
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Isotype: IgG
